<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12403
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MANKETEDQQRLRFQIELEFIQCLANPNYLNFLAQRGYLKDEAFVNYLKYLLYWKEPQYAKYLKYPMCLYFLDLLQYEHFRREIVNSQCAKFIDDQQVLLWQHYTRKRTKLLNEAAQNNISGVGRDSLQNNGNGANNGTTIKSESQ |
Length | 146 |
Position | Middle |
Organism | Diaphorina citri (Asian citrus psyllid) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Paraneoptera> Hemiptera> Sternorrhyncha> Psylloidea> Liviidae>
Diaphorina.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.706 |
Instability index | 38.50 |
Isoelectric point | 8.37 |
Molecular weight | 17405.50 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP12403
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.26| 14| 15| 20| 33| 1
---------------------------------------------------------------------------
20- 33 (26.92/17.59) FIQCLANPNYLNFL
38- 51 (24.34/15.30) YLKDEAFVNYLKYL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.63| 11| 15| 52| 62| 2
---------------------------------------------------------------------------
52- 62 (22.77/13.27) LYWKE.PQYAKY
69- 80 (16.85/ 8.25) LYFLDlLQYEHF
---------------------------------------------------------------------------
|