<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12399
Description |
mediator of RNA polymerase II transcription subunit 15a |
Sequence | MDTNNCRPTQGGIEAGDWRPQLHPDCRSWIVEKITETLKRHHSVSGQEGLSELRKMAVRFEEKIYTQASRQLDYLKKISLKMLIIESVTQHPMGNSLPSNRINNIEDPELEYLSEDELFTKMIEEEWNWGKVMGFIAKIK |
Length | 140 |
Position | Tail |
Organism | Cucumis melo (Muskmelon) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.677 |
Instability index | 53.85 |
Isoelectric point | 5.83 |
Molecular weight | 16332.49 |
Publications | PubMed=22753475
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP12399
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.74| 16| 36| 71| 86| 1
---------------------------------------------------------------------------
71- 86 (26.03/14.06) QLDYLKKISLKMLIIE
109- 124 (26.72/14.55) ELEYLSEDELFTKMIE
---------------------------------------------------------------------------
|