<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12398

Description U-box domain-containing protein 34-like
SequenceMFVEVGRSPFTRPGSRASMSKVMDPLMVDSDISFVSSGRRSTDYCLSGAWNSNIATGGDSFRLSNASEFEVFSPGPTSPLMLEMGEGTNKSVDSNTNDNYNDNTHSFPQDMSFCSSPSETFSWPSHSQTQDDVEAEMRRLKLELKQTMDMYSTACKEAITAKQKAMELHRWKVEEEQRLEAARMAEEAALAMAEKEKIKCKAAMEAAEAAQRNAALEAKKRARVEKMVDMEAQEMKRTLSFSGYGQAEIGYRKYTIQEIETATKGFSDSLKIGEGGYGPVFRGELDHTPVAIKVLRPDAAHGRSQFQQEVEVLSCIRHPNMVLLLGACPEKGCLVYEFMANGSLEDCLFRKANDPILSWQLRFRIAAEIATGLLFLHQTRPEPIVHRDLKPGNILLDSNYVSKISDVGLARLVPPSVADSVTQYRMTATAGTFFYIDPEYQQTGLLGIKSDIYSLGVMLLQIITARPPIGLAHAVERAIEKGKFAEILDPEVKDWPVEDALKFAKLSIKCAEMRKRDRPDLGKVVLPELNRLRTMAEESMGLGSFCCSSTSSSPYASQTSQEMMNSVRQQAGAWVETSSSQSDSSTSSYTREKPYWVD
Length598
PositionTail
OrganismCucumis melo (Muskmelon)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis.
Aromaticity0.08
Grand average of hydropathy-0.406
Instability index47.64
Isoelectric point5.57
Molecular weight66484.75
Publications
PubMed=22753475

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12398
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|      99.32|      23|      24|     168|     190|       1
---------------------------------------------------------------------------
  137-  155 (24.24/11.22)	............M...RRLKLELKQTMDMYSTAC
  156-  186 (28.72/14.40)	KEAItakqkameL...HRWKVEEEQRLEAARMAE
  187-  211 (25.60/12.19)	EAAL.......aM..aEKEKIKCKAAMEAAEAAQ
  213-  235 (20.77/ 8.76)	NAAL.........eakKRARVEKMVDMEAQEM..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.84|      19|      24|     551|     574|       2
---------------------------------------------------------------------------
  551-  574 (29.04/29.31)	SSSPYASQTSqemmnSVRQQAGAW
  578-  596 (35.80/21.88)	SSSQSDSSTS.....SYTREKPYW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     170.93|      44|      47|      15|      61|       4
---------------------------------------------------------------------------
   15-   58 (76.29/40.24)	SRASMSKVMDPLMVDSDISFVSSG.RRSTDYCLSGAWNSNIATGG
   64-  106 (60.36/34.13)	SNASEFEVFSPGPTSPLMLEMGEGtNKSVDSNTNDNYNDNTHS..
  108-  131 (34.29/15.10)	..............PQDMSFCSSP.SETF......SWPSHSQTQD
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12398 with Med32 domain of Kingdom Viridiplantae

Unable to open file!