<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12394
| Description |
mediator of RNA polymerase II transcription subunit 19a-like |
| Sequence | MESEDKKFGRGPRELTGAVDLISHYKLLPHHDFFCKKSLPLSISDTHYLHNVVGDTEIRKGEGMQLNQLIQNTSYPRETNARIQPFDQDILIEAFQLRETGPVDLPSAEKGVPTIPGKSKSESKDKDRKHKKHKDRDKEKDREHKKHKHRHKDRSKDKDKDKKKDKSGHQDSGADHSKKHHEKKRKHDGEDDINDIHRHKKSKHKASKIEEMGVIKVAG |
| Length | 219 |
| Position | Head |
| Organism | Cucumis melo (Muskmelon) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.512 |
| Instability index | 37.31 |
| Isoelectric point | 9.51 |
| Molecular weight | 25351.22 |
| Publications | PubMed=22753475
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12394
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.31| 16| 16| 124| 139| 1
---------------------------------------------------------------------------
124- 139 (29.95/11.61) KDKDRKHKK..HKDRDKE
158- 175 (22.35/ 6.72) KDKDKKKDKsgHQDSGAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.25| 13| 33| 144| 157| 2
---------------------------------------------------------------------------
144- 157 (21.52/11.58) HKKhKHRHKDRSKD
176- 188 (25.73/ 9.93) HSK.KHHEKKRKHD
---------------------------------------------------------------------------
|