<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12384

Description U-box domain-containing protein 34-like
SequenceMPTITAITTPSGESIPVNVLDDNVVEMYIEDMMAKCKEIFIPFKNLCKRKSVETVVLEGDNPATLLLQYVTQAGINALVLGSSSPSYFSRRQKDSGVPSVILKHAPESCDVYVVSSNGLVKNSLSPLLPTETEVHTINQQESNVSYAAMEFNRRASSLPDFTHLNSPAFAHGNSNIHFRSQQRYKQNVEEFTAGPEVVKGGHSSTCSEQSDIQAEMERMRLELQNTIAMYNQTCEHLIHAQNKVQLLSSECLEEARRVNAAQKREESLRKTAAEAKKKHVETEKEVRIARKLLAKEACERQIAELKALQQSLEKQKVVNALMSCDGRYRRLTREEIEVATDFFSESKMIGEGGYGKVYKGNLDHTPVAIKILHPDASQKKEEFLREVEVLSQLHHPNIVLLLGASPENGCLVYEYMENGSLEDYIFQGKNRPLPWFVRFRILFEVAYGLAFLHNSKPEPIVHRDLKPGNILLDKNYVSKIGDVGLAKIMSDIVPESITEYRDSIIAGTLAYMDPEYQRTGTLRPKSDLYAFGIIALQLLAACHPNGLIMKIEKAIDSNSLVNVLDKSVVDWPLIEAEELAKMALQCCKLRCRDRPDLETEVLPLLKKLFEFAEMHVKVEKNLIQAPSQYFCPILQEVMQNPHIAADGFTYEHRAIKAWIDRHNVSPVTKQRLQHKMLTPNHTLRLAIQDWRSHS
Length694
PositionTail
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.07
Grand average of hydropathy-0.337
Instability index56.72
Isoelectric point6.47
Molecular weight78476.17
Publications
PubMed=24807620

Function

Annotated function Functions as an E3 ubiquitin ligase.
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12384
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      95.39|      27|      27|     258|     284|       1
---------------------------------------------------------------------------
  258-  284 (40.89/26.62)	VNAAQK..REESLRKTAAEAKKKHVETEK
  286-  314 (35.19/21.95)	VRIARKllAKEACERQIAELKALQQSLEK
  318-  334 (19.31/ 8.94)	VNALMS..CDGRYRRLTRE..........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     139.54|      41|     543|      17|      57|       3
---------------------------------------------------------------------------
   17-   57 (71.72/50.43)	VNVLDDNVVEMYIEDMMAKCKEIFIPFKNLCK.RKSVETVVL
  561-  602 (67.82/47.30)	VNVLDKSVVDWPLIEAEELAKMALQCCKLRCRdRPDLETEVL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.86|      22|      29|     139|     167|       4
---------------------------------------------------------------------------
  139-  162 (31.77/39.26)	QQESNVSYAAMEfnRRASSLPDFT
  171-  192 (39.09/22.79)	HGNSNIHFRSQQ..RYKQNVEEFT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.82|      15|      20|      72|      86|       6
---------------------------------------------------------------------------
   72-   86 (23.72/14.74)	QAGINALVLGSSSPS
   94-  108 (25.10/16.00)	DSGVPSVILKHAPES
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12384 with Med32 domain of Kingdom Viridiplantae

Unable to open file!