<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12378
Description |
mediator of RNA polymerase II transcription subunit 23-like |
Sequence | AETTVINQCTQLLSPSADPTYVMTYINHSFPQHRQYLCAGAWILMHGHPENINCINLGRVLREFSPEEVTANIYTMVDVLLHHIHLELQRGHPLQDLMLKACGNLSIFIWTHELLPPDILLLALIDRDDNPHALRIVINLLDSKELQQRVKLYLINRGPPEHWLSSGPFKRVELQKALGNYLSWKER |
Length | 187 |
Position | Tail |
Organism | Nicotiana tabacum (Common tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.144 |
Instability index | 48.04 |
Isoelectric point | 6.42 |
Molecular weight | 21581.75 |
Publications | PubMed=24807620
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
transcription regulator complex GO:0005667 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | positive regulation of gene expression GO:0010628 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP12378
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.56| 13| 27| 122| 148| 1
---------------------------------------------------------------------------
122- 134 (23.54/28.18) LALIDRDDNPHAL
152- 164 (27.03/ 6.89) LYLINRGPPEHWL
---------------------------------------------------------------------------
|