<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12377
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSTATYPPPPPYYRLYKDYLQDPNSAPEPPPPIDGTYILFGSNYTTDDALPSLEDQGVRQLYPKGSNVDFKKELRALNRELQLHILELADVLVERPSQYARRVEEISLIFKNLHHLLNSLRPHQVNIGESKFPNIP |
Length | 136 |
Position | Middle |
Organism | Nicotiana tabacum (Common tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.613 |
Instability index | 65.91 |
Isoelectric point | 5.77 |
Molecular weight | 15613.49 |
Publications | PubMed=24807620
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP12377
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.67| 13| 21| 4| 16| 1
---------------------------------------------------------------------------
4- 16 (29.96/11.74) ATYPPPP..PYYRLY
26- 40 (23.71/ 8.14) APEPPPPidGTYILF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.86| 14| 22| 41| 54| 2
---------------------------------------------------------------------------
41- 54 (24.45/19.43) GSNYTTDDALPSLE
65- 78 (23.41/18.33) GSNVDFKKELRALN
---------------------------------------------------------------------------
|