<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12373
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MLQNVQHQLLQSPARLGLPTPSSPSLQNPTAPPKFSSQVSQHLQPHQQANILTTTTTSSTLLPLLPPLSRAQSLLIQMASLSSRLFEVSPNRSHWLSAFRGSFPAFLPSAAPVPQDSYPSSSKETLSVFTSLQTQLFEAVAELQEILDLQDEKQKVTREIRSNDSAILAFANKLKGAERVLDNLVDDYSDYRRPKRVKLENDIDESSVTTVATQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYNFANLDVGLPKTDDDKEKIIEPLIEPSADITNLSAIPGLIPPNIIVPSGWKPGMPVELPTDLPLPPPGWKPGDPIALPPVDSLPLPPKVEEAPARPVPPPGLPRMPEPIQVRHVQLDIEDDSSDYSSEASSDSED |
Length | 398 |
Position | Middle |
Organism | Nicotiana tabacum (Common tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.386 |
Instability index | 76.23 |
Isoelectric point | 4.84 |
Molecular weight | 43438.57 |
Publications | PubMed=24807620
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP12373
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 110.78| 18| 18| 312| 329| 1
---------------------------------------------------------------------------
235- 251 (23.84/ 7.17) P......EFGAGQaP..LRG.A.LPPA
312- 328 (32.85/12.65) .......GWKPGM.PVELPT.D.LPLP
329- 349 (27.69/ 9.51) P.....pGWKPGD.PIALPPvDsLPLP
350- 371 (26.40/ 8.73) PkveeapA.RPVP.PPGLPR...MPEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.71| 19| 50| 67| 87| 2
---------------------------------------------------------------------------
78- 127 (13.86/ 6.80) MASLSSRLFEvspnrshwlsafrgsfpaflpsaapvpqdsyPSSSKETLS
129- 147 (27.85/ 8.64) FTSLQTQLFE...............................AVAELQEIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.42| 9| 19| 178| 196| 3
---------------------------------------------------------------------------
181- 189 (16.52/ 8.73) LDNLVDDYS
199- 207 (15.91/10.53) LENDIDESS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.85| 15| 19| 273| 289| 4
---------------------------------------------------------------------------
275- 289 (25.78/18.56) TDDDKEKIIEPLIEP
291- 305 (26.07/10.99) ADITNLSAIPGLIPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.91| 19| 20| 27| 45| 5
---------------------------------------------------------------------------
11- 24 (23.74/ 7.73) Q.SP.ARLGLPTPSS....P
27- 45 (34.90/14.64) Q.NPTAPPKFSSQVSQHLQP
48- 67 (25.27/ 8.68) QaNILTTTTTSSTLLPLLPP
---------------------------------------------------------------------------
|