<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12373

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMLQNVQHQLLQSPARLGLPTPSSPSLQNPTAPPKFSSQVSQHLQPHQQANILTTTTTSSTLLPLLPPLSRAQSLLIQMASLSSRLFEVSPNRSHWLSAFRGSFPAFLPSAAPVPQDSYPSSSKETLSVFTSLQTQLFEAVAELQEILDLQDEKQKVTREIRSNDSAILAFANKLKGAERVLDNLVDDYSDYRRPKRVKLENDIDESSVTTVATQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYNFANLDVGLPKTDDDKEKIIEPLIEPSADITNLSAIPGLIPPNIIVPSGWKPGMPVELPTDLPLPPPGWKPGDPIALPPVDSLPLPPKVEEAPARPVPPPGLPRMPEPIQVRHVQLDIEDDSSDYSSEASSDSED
Length398
PositionMiddle
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.05
Grand average of hydropathy-0.386
Instability index76.23
Isoelectric point4.84
Molecular weight43438.57
Publications
PubMed=24807620

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP12373
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     110.78|      18|      18|     312|     329|       1
---------------------------------------------------------------------------
  235-  251 (23.84/ 7.17)	P......EFGAGQaP..LRG.A.LPPA
  312-  328 (32.85/12.65)	.......GWKPGM.PVELPT.D.LPLP
  329-  349 (27.69/ 9.51)	P.....pGWKPGD.PIALPPvDsLPLP
  350-  371 (26.40/ 8.73)	PkveeapA.RPVP.PPGLPR...MPEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.71|      19|      50|      67|      87|       2
---------------------------------------------------------------------------
   78-  127 (13.86/ 6.80)	MASLSSRLFEvspnrshwlsafrgsfpaflpsaapvpqdsyPSSSKETLS
  129-  147 (27.85/ 8.64)	FTSLQTQLFE...............................AVAELQEIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.42|       9|      19|     178|     196|       3
---------------------------------------------------------------------------
  181-  189 (16.52/ 8.73)	LDNLVDDYS
  199-  207 (15.91/10.53)	LENDIDESS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.85|      15|      19|     273|     289|       4
---------------------------------------------------------------------------
  275-  289 (25.78/18.56)	TDDDKEKIIEPLIEP
  291-  305 (26.07/10.99)	ADITNLSAIPGLIPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.91|      19|      20|      27|      45|       5
---------------------------------------------------------------------------
   11-   24 (23.74/ 7.73)	Q.SP.ARLGLPTPSS....P
   27-   45 (34.90/14.64)	Q.NPTAPPKFSSQVSQHLQP
   48-   67 (25.27/ 8.68)	QaNILTTTTTSSTLLPLLPP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12373 with Med4 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LQSPARLGLPTPSSPSLQNPTAPPKFSSQVSQHLQPHQQANIL
2) PVELPTDLPLPPPGWKPGDPIALPPVDSLPLPPKVEEAPARPVPPPGLPRMPEPIQVRHVQLDIEDDSSDYSSEASSDSED
10
318
52
398










Molecular Recognition Features






MoRF SequenceStartStop




1) PGLPRMPEPIQVRHVQLDIEDDSSDYS
363
389