<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12366

Description mediator of RNA polymerase II transcription subunit 4-like
SequenceMLQNVPHQLLQSPARLGLPTPSSPSVQNPNPPPKFSSQVSQPNQPLQQANILTTSTTSSMLLPLLPPLSRAQSLLIQMASLASRLFEVSPNRSHWLSAFRGSFPSFLPSATPVPQDSFPSSSKEILSVFTSLQTQLFEAVAEL
Length143
PositionMiddle
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.06
Grand average of hydropathy-0.094
Instability index87.99
Isoelectric point9.96
Molecular weight15488.53
Publications
PubMed=24807620

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12366
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.89|      18|      34|       6|      23|       1
---------------------------------------------------------------------------
    6-   23 (33.85/18.98)	PHQLLQSPARLGLPTPSS
   42-   59 (32.04/17.58)	PNQPLQQANILTTSTTSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.44|      19|      49|      69|      87|       2
---------------------------------------------------------------------------
   69-   87 (30.62/19.70)	SRAQSLLIQMASLASRLFE
  120-  138 (30.82/19.88)	SSSKEILSVFTSLQTQLFE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12366 with Med4 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) LLQSPARLGLPTPSSPSVQNPNPPPKFSSQVSQPNQPLQQANIL
9
52

Molecular Recognition Features

MoRF SequenceStartStop
NANANA