<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12366
| Description |
mediator of RNA polymerase II transcription subunit 4-like |
| Sequence | MLQNVPHQLLQSPARLGLPTPSSPSVQNPNPPPKFSSQVSQPNQPLQQANILTTSTTSSMLLPLLPPLSRAQSLLIQMASLASRLFEVSPNRSHWLSAFRGSFPSFLPSATPVPQDSFPSSSKEILSVFTSLQTQLFEAVAEL |
| Length | 143 |
| Position | Middle |
| Organism | Nicotiana tabacum (Common tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.094 |
| Instability index | 87.99 |
| Isoelectric point | 9.96 |
| Molecular weight | 15488.53 |
| Publications | PubMed=24807620
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12366
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.89| 18| 34| 6| 23| 1
---------------------------------------------------------------------------
6- 23 (33.85/18.98) PHQLLQSPARLGLPTPSS
42- 59 (32.04/17.58) PNQPLQQANILTTSTTSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.44| 19| 49| 69| 87| 2
---------------------------------------------------------------------------
69- 87 (30.62/19.70) SRAQSLLIQMASLASRLFE
120- 138 (30.82/19.88) SSSKEILSVFTSLQTQLFE
---------------------------------------------------------------------------
|