<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12363

Description U-box domain-containing protein 33-like isoform X2
SequenceMALESPVPEIRQSPVRYPEVDLSGLNLNEEIESPLTPPARVADDMIYVAVGKDLKESEPTLKWALHKSGGRRICILHVHTPAQKIPMMGTKFNIDQLDVHQVRAYHEKERQDMHKILEKYILICGRAGVRADKLVVEMDSIETGIVELVSQRGIGKLVMGAAANKCYSKKMTDLRSKKAIYVRLQAPTFCCIWFVCKGNLIYTRESESERPNTDSVSPPIPVSPENDTVLRSRSVTEGYNEQVGLRGPFNEYRRVASDNHRIIFSGPPSGGTLRANFPSMSSDRSPSVASRFSSSSYGEMVGDSPTISLARTEGNETAIDSSTLHHFILGHHQPSSPSIAESLNDEPAGSMNDELLDRLDQYVAEAEDARREAFEESIKRRKAEKDAIEARRRAKASETIYADELRQRRDIEEALAKSKEEANQMKSKLNKMLADLQAAQAQTSSLERQLLNSDTTVQELEQKMFSAVDLLQKYRKERDELQVERDDALNIAEALREQHSNGSSTTSASVLFAEFYFHEIEEATRRFDPALKIGEGGYGSIYRGLLRHTHVAIKMLHPHSSQGPSEFQQEVNILSKLRHPNIVTLIXPNIVTLIGACPEAWALVYEYLPNGSLEDRLTCKDNTPPLSWQTRIRVASELCSALIFLHSCTARGIIHGDLKPANILLDANFVSKLSDFGICRVLPEDEFSEKSTSLCYRTDPKGTFAYLDPEFLDTGELTPKSDVYSFGIILLRLLTGRPALGINNEVQYALDKGNLKDLLDPTAGDWPFVQAKQLAHLAMNCCEKNRRLRPELSSEVWKVLEPMRASCGASSFRMSSEERCEIPSYFICPIFQETMQDPVVAADGFTYEAEALRGWLDSGHDTSPMTNLALSNTNLVPNHALRSAIQEWLQQH
Length892
PositionTail
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.07
Grand average of hydropathy-0.431
Instability index56.38
Isoelectric point5.69
Molecular weight99796.87
Publications
PubMed=24807620

Function

Annotated function Functions as an E3 ubiquitin ligase.
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12363
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     392.73|     127|     219|       6|     139|       1
---------------------------------------------------------------------------
    6-  139 (205.60/143.91)	PV.PEiRQSPVRYPEVDlSGLNLNEEIESPLTPPARVADD...MIYVA..VGKDLKESEPTLKWALHKSGGRRICIL...HVHTPAQKIPMMGTKFN...IDQLDVHQ.VRAYHEKERQDMHKILEKyilicGRAGVRADKLVVEMD
  221-  360 (187.13/113.52)	PVsPE.NDTVLRSRSVT.EGYNEQVGLRGPFNEYRRVASDnhrIIFSGppSGGTLRANFPSMSSDRSPSVASRFSSSsygEMVGDSPTISLARTEGNetaIDSSTLHHfILGHHQPSSPSIAESLND.....EPAGSMNDELLDRLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      98.37|      32|      54|     403|     444|       2
---------------------------------------------------------------------------
  370-  393 (29.16/15.05)	....RREA....FEESIKRRKAEKD..............AIEARRR
  403-  444 (43.05/44.84)	DELRQRRD....IEEALAKSKEEANQMKSklnkmladlqAAQAQTS
  479-  507 (26.16/ 9.73)	DELQVERDdalnIAEALREQHSNGSSTTS.................
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12363 with Med32 domain of Kingdom Viridiplantae

Unable to open file!