<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12358

Description pre-mRNA-processing protein 40A-like isoform X4
SequenceMASNPPPSGPQPLWPPSVGSTPPQGFGSSFPMQFRPAVSTQQGQPFASSISASPQYRPIGQTPNAGMPPGHGQIPQFSQPMQQFPPRPSQPGHGILSSQAIQMPFIQSSMPQPQQVIPPLNSHMPGVSGAGNPFSSSYTVQSSSQMHVPPFPSGGQPWLSSGSQTTPVAAPTLLTSQQLSAIAPSVPAGTASQQNASDWQEYEAADGRRYYYNKITKQSSWEKPLELMTTLERADASTVWKEFTTADGRKYYYNKETKQSKWTIPEELKLARELAEISADQVVQTGASTISGVQVTAAVTSTEQPSAVTPASSTPSSTVSGVASSPVPVTSAVSDHASPLVVSGSSAIPAVTPAMPSSSGVSSPAVSGSTGSATLANASQKQMSGFENLSPQVASSLSGASIQDIEEAKKGMAVAGKVNVVPAEEKTTEEEPFLYATKQEAKNAFKALLEFANVESDWTWEQTMRVIINDKRYGALKTLGERKQAFNEYLMQRKKQEAEERRHRQRKAKEEFTKMLEESKELISSTRWSKAVTMFEDDERFKAVEREADREDLFRNYLVDLQKKERAKAQEEYRHNRLEYRQFLETCGFIKVDTQWRKVQDLLEDDERCSRLEKIDRLDIFQEYIRDLEKEDEEQRKLQKEQLRRTERKNRDAFRKMMEEQIAAGTLTAKTSWRDYCQMVKEYVAYQAVASNTSGSTPKDLFEDVVEELEKQYHEDKIRVKDVVKSEKITISSTWTFEDFKAAILEGIGSPSIHDVNLQLIFEDIIERAKEKEEKESKKRQRLAKDFTDKLSTIKEITASSSWEECKELVEDSSEFRAIGEETISRAVFEEYVAWLQEKAKEKERRREEEKAKKEKEKEEKEKRKDKERREKEREKEKEREKEKERGKERSTKDEADSESMDVTDNYEPKEERKREKDKERKHRKRHHISNDEVTSDKDEKVEPERDKERKHRKRHHSSNDEVASDKDEKEESKRSRRHSSDRKKSKKLAHSPESDGESRHKRHRRDHRDGSRRNGGYEELEDGELGEDGES
Length1032
PositionUnknown
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.06
Grand average of hydropathy-1.082
Instability index61.88
Isoelectric point6.14
Molecular weight117258.81
Publications
PubMed=24807620

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
GO - Biological Process
mRNA cis splicing, via spliceosome	GO:0045292	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12358
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             7|     219.98|      28|      28|     916|     943|       1
---------------------------------------------------------------------------
  771-  804 (22.77/ 6.47)	EKEE......KESKKRQRlakdftDKLSTiKEITasSSWE
  860-  879 (23.89/ 7.13)	EK...ekRKDKERREKER......EK...........EKE
  880-  908 (30.34/10.98)	REKE..kERGKERSTKDE......ADSES.MDVT..DNYE
  909-  939 (46.16/20.43)	PKEErkrEKDKERKHRKR......HHISN.DEVT..SDKD
  940-  968 (45.80/20.22)	EKVE..pERDKERKHRKR......HHSSN.DEVA..SDKD
  969-  988 (23.30/ 6.78)	EKEE.........SKRSR......RH.SS.DRKK..SKK.
 1005- 1031 (27.73/ 9.42)	.RRD...HRDGSRRNGGY......EELED.GELG..EDGE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     145.18|      38|      38|     190|     227|       2
---------------------------------------------------------------------------
  190-  227 (75.20/39.46)	TASQQNASD.WQEYEAADGRRYYYNKITKQSSWEKPLEL
  230-  268 (69.97/36.28)	TLERADASTvWKEFTTADGRKYYYNKETKQSKWTIPEEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     153.55|      21|      23|      54|      74|       3
---------------------------------------------------------------------------
   15-   34 (18.81/ 6.06)	PPsVGSTP....P..Q....GFG.............sSFpMQF
   35-   56 (26.38/11.73)	RP.AVST.QQGQPfaS....SIS..............AS.PQY
   57-   77 (40.58/22.37)	RP.IGQTPNAGMP..P....GHG..............QI.PQF
   79-  113 (27.05/12.24)	QP.MQQFPPRPSQ..P....GHGilssqaiqmpfiqsSM.PQP
  309-  326 (20.33/ 7.20)	TP.ASST.PSSTV..S....GVA..............SS.P..
  327-  351 (20.40/ 7.25)	VP.VTSAVSDHAS..PlvvsGSS..............AI.PAV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      81.86|      23|      23|     585|     607|       4
---------------------------------------------------------------------------
  477-  500 (19.17/ 8.49)	KTL.......GerkqaFNEY.........LMQ.RKKQ...EAEE
  501-  539 (21.14/10.19)	RRHrqrkakeE.....FTKMleeskelisSTRWSKAVTMFEDDE
  585-  607 (41.56/27.71)	ETC.......G.....FIKV.........DTQWRKVQDLLEDDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     163.52|      39|     207|     613|     651|       5
---------------------------------------------------------------------------
  549-  577 (43.88/20.89)	...............DREDLFRNYLVDLQ...KK.....ERAKAQ.EEYR....HNR
  613-  651 (65.15/34.44)	EKI............DRLDIFQEYIRDLE...KEDE...EQRKLQKEQLRRTERKNR
  660-  699 (27.12/10.20)	EQIaagtltaktswrDYCQMVKEYV..............AYQAVASNTSGSTPK...
  822-  855 (27.37/10.35)	ETI............SR.AVFEEYVAWLQekaKEKErrrEEEKAKKE..........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.25|      15|      22|     123|     137|       6
---------------------------------------------------------------------------
  123-  137 (28.67/16.52)	HMPGVSGAGNPFSSS
  147-  161 (34.58/21.62)	HVPPFPSGGQPWLSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.12|      14|      22|     726|     746|       7
---------------------------------------------------------------------------
  726-  739 (24.93/31.72)	SEKIT.ISSTWTFED
  750-  764 (20.19/ 6.10)	SPSIHdVNLQLIFED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.30|      19|      73|     286|     304|       8
---------------------------------------------------------------------------
  286-  304 (30.38/16.69)	GAS..TISGVQ.VTAAVTSTEQ
  377-  398 (22.92/10.95)	NASqkQMSGFEnLSPQVASSLS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12358 with Med35 domain of Kingdom Viridiplantae
Unable to open file!