<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12352
Description |
mediator of RNA polymerase II transcription subunit 25-like |
Sequence | MQIVRLISQDHMNNKQYVGKADFLVFRAMNQHGFLSQLQEKKLCAVIQLPSQTLLLSVSDKACRLIGMLFPGDMVVFKPQIPSQQQQQQQLQAQHPQLQQQQLSQQQQHLSQLQQQPLQQLQQQQPLMQLQQQQQIPLQQQSQIPQMQQQQIHQMQQQQLPQMQQQQQIPQMQQPQQIPQMQQPQQQQPMVGTGVNQSYMQGPARSQLMSQGQVSSQGLPTMPGGGFMN |
Length | 229 |
Position | Unknown |
Organism | Nicotiana tabacum (Common tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.804 |
Instability index | 89.72 |
Isoelectric point | 9.62 |
Molecular weight | 26370.96 |
Publications | PubMed=12393816
PubMed=24807620
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
transcription regulator complex GO:0005667 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP12352
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.45| 19| 46| 119| 141| 3
---------------------------------------------------------------------------
119- 137 (38.96/13.47) QQLQQQQPLMQLQQQQQIP
161- 179 (38.49/ 6.18) PQMQQQQQIPQMQQPQQIP
---------------------------------------------------------------------------
|