<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12351
| Description |
mediator of RNA polymerase II transcription subunit 19a-like isoform X2 |
| Sequence | MDSDSKNFGRGPRELTDTHYLHNVVGDREIRKGEGMQLDQLTQDTSFSREIKSCIRPFDLDVLREAFQLRETAPVDLSPSEKGIPTIAGKSKSEMKDKEKKHKKHKDKDKEKDKEHKKHKHRHKDRSKEKKKDKSGHHDPGAEHSKKHEKKRKHDEEDLNGVHKHKKSKHKSSKIDEIGAIKVAV |
| Length | 185 |
| Position | Head |
| Organism | Nicotiana tabacum (Common tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.628 |
| Instability index | 39.05 |
| Isoelectric point | 9.60 |
| Molecular weight | 21452.96 |
| Publications | PubMed=24807620
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12351
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.03| 16| 40| 121| 136| 2
---------------------------------------------------------------------------
121- 136 (28.23/ 9.85) HRHKDRSKEK..KKDKSG
143- 158 (26.14/ 8.61) EHSKKHEKKR..KHDEED
163- 179 (22.66/ 6.54) HKHK.KSKHKssKIDEIG
---------------------------------------------------------------------------
|