<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12350
| Description |
mediator of RNA polymerase II transcription subunit 19a-like isoform X1 |
| Sequence | MDSDSKNFGRGPRELTGARDLISHFKLLPHYEFFCKRSLPLSISDTHYLHNVVGDREIRKGEGMQLDQLTQDTSFSREIKSCIRPFDLDVLREAFQLRETAPVDLSPSEKGIPTIAGKSKSEMKDKEKKHKKHKDKDKEKDKEHKKHKHRHKDRSKEKKKDKSGHHDPGAEHSKKHEKKRKHDEEDLNGVHKHKKSKHKSSKIDEIGAIKVAV |
| Length | 213 |
| Position | Head |
| Organism | Nicotiana tabacum (Common tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.402 |
| Instability index | 39.95 |
| Isoelectric point | 9.62 |
| Molecular weight | 24710.76 |
| Publications | PubMed=24807620
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP12350
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 76.70| 19| 19| 126| 144| 1
---------------------------------------------------------------------------
140- 161 (25.34/ 6.76) KDKEHkkhKH..RHKDRSKEKKKD
162- 181 (25.72/ 6.97) KSGHH..dPG..AEHSKKHEKKRK
182- 202 (25.64/ 6.93) HDEED...LNgvHKHKKSKHKSSK
---------------------------------------------------------------------------
|