<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12336
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASTPNPETDESAKSASSPQKSVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNPTFRNAMAHPANKEVAHRQQFYFWKNYRNNRLKHILPRPLPEPATAPATSAPLIVAPPAAPPPAPSPVSAVAPSPMQYAIPPGSGLAKTDPRSAAVDRRKRKKDG |
Length | 202 |
Position | Middle |
Organism | Nicotiana tabacum (Common tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.606 |
Instability index | 63.90 |
Isoelectric point | 9.37 |
Molecular weight | 22987.99 |
Publications | PubMed=24807620
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP12336
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.56| 16| 18| 64| 79| 1
---------------------------------------------------------------------------
40- 58 (23.45/11.94) FVQC...LanpTYIHYLAQNRY
64- 79 (32.73/18.91) FIGY...L...KYLQYWQRPEY
82- 100 (23.38/11.89) FIMYphcL...FFLELLQNPTF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.47| 19| 21| 136| 155| 2
---------------------------------------------------------------------------
134- 153 (31.90/15.71) PRPLPEPATAP....ATSaPLIVA
154- 176 (35.57/14.37) PPAAPPPAPSPvsavAPS.PMQYA
---------------------------------------------------------------------------
|