<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12332
Description |
mediator of RNA polymerase II transcription subunit 4-like |
Sequence | MLVDDYSDYRRPKRAKLENDTEESSVTTVATQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYNFADLDVGLPKLDEGKEKIIEPLIEPAVETNPLANIQGLITPNIVVPSGWKPGMPVELPTDLPLPPPGWKPGDPIALPPFDSLSLPPKVEEVPARPVPPPGLPRMPEPIQVRHVQLDIEDDSSDYSSDEASSDSED |
Length | 217 |
Position | Middle |
Organism | Nicotiana tabacum (Common tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.499 |
Instability index | 71.26 |
Isoelectric point | 4.37 |
Molecular weight | 23702.40 |
Publications | PubMed=24807620
|
Function
Annotated function |
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP12332
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 99.68| 18| 18| 130| 147| 1
---------------------------------------------------------------------------
54- 68 (27.03/ 8.81) EFGAGQA...P..LRGALPP
130- 147 (40.10/15.98) GWKPGMPVELP..TDLPLPP
149- 168 (32.55/11.84) GWKPGDPIALPpfDSLSLPP
---------------------------------------------------------------------------
|