<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12330
| Description |
probable mediator of RNA polymerase II transcription subunit 26c |
| Sequence | MELDEFRLMLENSSVDLWTFIDTAISVAIRDHENELLSRRDAIVEKLNAPLLCKNCNSAGNYEDLETKIIRIKKLLEYPNQSENCLVELLQTLAEMDISFKVLEITDVGRHVNRLRKHSSNEVRRLVKLLIRRRKDIVDEWVRLNTPPEETGDADSPFQPHLNNNFEERAPLYGISPNGSSSYCARKVFS |
| Length | 190 |
| Position | Unknown |
| Organism | Nicotiana tabacum (Common tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.472 |
| Instability index | 39.61 |
| Isoelectric point | 5.49 |
| Molecular weight | 21970.73 |
| Publications | PubMed=24807620
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12330
No repeats found
|