<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12318

Description U-box domain-containing protein 52-like isoform X2
SequenceMRPPPTAGNHGPPLNKLIAVAIDKDRGSQVALKWAIDNLLARGQTVILIHVKVKPSASQPPSHTTSRLNQMSDASTDGSGMSELDPQLKELFLPFRVFCTRKDIQCYDVVLEDVDVVKAIVEYVNRTAIEVLILGAAAKGGLLRFKVKDIPGNVVKGVPDFCTVYVISKNGKISATRSASRLAPFIHPLRHQFMQQGNAKSNTTEDSLNTPSRGSLSGIPKPVSDLPMSNLQSDTLNMKSPFTHRKGPNGKPYEISQPDTDISFVSSGRPSIDNMFPSFADNYDSGATPPRLSGFSDFEAQNFEPIPLGRRSLDIMPSELSFLSMEGDRASFSSTPDDVAAEMRRLKLELKQTMEMYSTACKEALTAQQKAMELQRWKTEEQRRLEEARFAEEAALALAEKEKAKSRAALEHAEAAQRLAELEAQKRINAEMKALKEAEERNKVLNKLSNSDFRYRRYTIEEIETATDYFAQANKIGEGGYGPVYKCYMDHTPVAVKVLRPDAAHGRQQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEFMSNGSLEDRLFQRGKTPPLSWQQRFRIAAEIGAGLLFLHQSKPEPIVHRDLKPANILLDRNFVSKISDVGLARLVPPSVADCVTQYRMTSTAGTFCYIDPEYQQTGMLGIKSDVYSLGIIFLQILTAKPPMGLTHHVERAIEKGTFNEMLDSSVPDWPLDEALNLAKLSLKCSELRRKDRPDLSKVIMPELERLRTLGEENPCQSPLYSSGSSSNHSQAFVSQASQHE
Length770
PositionTail
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.07
Grand average of hydropathy-0.405
Instability index44.75
Isoelectric point6.98
Molecular weight85661.76
Publications
PubMed=24807620

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12318
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.77|      12|      27|     201|     212|       1
---------------------------------------------------------------------------
  201-  212 (21.53/12.15)	SNTTEDSLNTPS
  229-  240 (21.24/11.91)	SNLQSDTLNMKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.49|      13|      23|     362|     374|       2
---------------------------------------------------------------------------
  362-  374 (20.78/13.19)	KEALTAQQKAMEL
  386-  398 (18.71/11.17)	EEARFAEEAALAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.18|      21|      91|     640|     660|       4
---------------------------------------------------------------------------
  640-  660 (39.12/26.00)	IDPEYQQTGMLG....IKSDVYSLG
  729-  753 (34.06/21.70)	IMPELERLRTLGeenpCQSPLYSSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.23|      17|      17|     266|     282|       7
---------------------------------------------------------------------------
  266-  282 (32.21/21.41)	SSGRPSIDNMFPSF.ADN
  285-  302 (27.02/16.68)	SGATPPRLSGFSDFeAQN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.61|      23|     394|     112|     136|       8
---------------------------------------------------------------------------
  112-  136 (31.96/27.99)	EDVDVVKAIveYVNRTAIEVLILGA
  488-  501 (16.75/ 7.08)	...........YMDHTPVAVKVLRP
  512-  531 (34.90/23.63)	QEVEVLSCI.....RHPNMVLLLGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.79|      13|     432|     241|     259|       9
---------------------------------------------------------------------------
  213-  225 (23.55/10.37)	RGSLSGIPKPVS..D
  245-  259 (20.24/11.27)	RKGPNGKPYEISqpD
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12318 with Med32 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) LPMSNLQSDTLNMKSPFTHRKGPNGKPYEISQPDTDISF
2) MQQGNAKSNTTEDSLNTPSRGSLSGIPKPVS
226
194
264
224

Molecular Recognition Features

MoRF SequenceStartStop
NANANA