<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12310
| Description |
mediator of RNA polymerase II transcription subunit 32-like |
| Sequence | MVMDGIVESLNKAYQEFITAAAIVLETREIHGDQKTAAVSSAIENFHQHLLLFKSTCDEAEGFVDYLKHSLGCEKFPSYSPEHVSIDSDNIQCNPIPMEADDEKTKTSY |
| Length | 109 |
| Position | Tail |
| Organism | Nicotiana tabacum (Common tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.335 |
| Instability index | 29.45 |
| Isoelectric point | 4.62 |
| Molecular weight | 12184.48 |
| Publications | PubMed=24807620
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12310
No repeats found
No repeats found
|