<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12305
| Description |
mediator of RNA polymerase II transcription subunit 19a-like |
| Sequence | MDPDSKSFGRGPRELTGAVDLISHFKLLPHHEFFCKRSLPLSISDAHYLHNVVGDTEIRKGEGMQLDQLIQDTSLSRETSSRIQPFDLDVLGEAFQLREAAPVVLPPSEKGIPTVAGKSKSESKDKDKKHKKHRDKDKEKDKEHKKHKHRHKDRSKDKDKEKNRDKSGHHDSGADHSKKHREKKRKHDGEDLNDVHKHKRSKHKSSKIDEIGAIKVAG |
| Length | 218 |
| Position | Head |
| Organism | Nicotiana tabacum (Common tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.374 |
| Instability index | 38.37 |
| Isoelectric point | 9.56 |
| Molecular weight | 24900.71 |
| Publications | PubMed=24807620
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP12305
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.03| 14| 15| 129| 143| 1
---------------------------------------------------------------------------
129- 142 (27.26/10.39) KHKKHRDKDKEKDK
145- 158 (26.78/ 6.48) KKHKHRHKDRSKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 85.17| 17| 33| 159| 175| 2
---------------------------------------------------------------------------
159- 175 (31.92/14.42) DKEKNRDKSGHHDSGAD
177- 191 (26.62/10.77) SK.KHREKKRKHD.GED
194- 209 (26.63/10.78) DVHKHK.RSKHKSSKID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.72| 12| 14| 49| 60| 3
---------------------------------------------------------------------------
49- 60 (19.79/14.36) LHNVVGDTEIRK
66- 77 (18.93/13.48) LDQLIQDTSLSR
---------------------------------------------------------------------------
|