<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12278
| Description |
mediator of RNA polymerase II transcription subunit 21-like isoform X2 |
| Sequence | MSAAFVKAAKQFDALVAALPLSDGCEEAQLKRIAELQAESDVVGQELQKQLEAAGGPLPGICLGGTTNRLHQASYGCIY |
| Length | 79 |
| Position | Middle |
| Organism | Nicotiana tabacum (Common tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | 0.053 |
| Instability index | 46.21 |
| Isoelectric point | 4.87 |
| Molecular weight | 8262.35 |
| Publications | PubMed=24807620
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12278
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.45| 14| 36| 10| 25| 1
---------------------------------------------------------------------------
10- 25 (21.93/17.39) KQFDAlvAALPLSDGC
49- 62 (27.52/15.68) KQLEA..AGGPLPGIC
---------------------------------------------------------------------------
|