<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12276
Description |
mediator of RNA polymerase II transcription subunit 21-like isoform X1 |
Sequence | MSAAFVKAAKQFDALVAALPLSDGCEEAQLKRIAELQAESDVVGQELQKQLEAAEKELKQVQELFNQATDNCLNLKKPE |
Length | 79 |
Position | Middle |
Organism | Nicotiana tabacum (Common tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.352 |
Instability index | 48.03 |
Isoelectric point | 4.68 |
Molecular weight | 8673.77 |
Publications | PubMed=24807620
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP12276
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.24| 21| 27| 27| 49| 1
---------------------------------------------------------------------------
27- 49 (28.51/19.09) EAQLKRIAEL..QAESDVVgqELQK
55- 77 (30.72/14.83) EKELKQVQELfnQATDNCL..NLKK
---------------------------------------------------------------------------
|