<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12257

Description mediator of RNA polymerase II transcription subunit 25-like isoform X3
SequenceMCKNALGAEKRLLIKQRKASQLEPRLEIRQKRKRGIKESEELKAEVRARTTRGEQQSICRIFGKAHMMEKQLIVAVEGTAAVGPFWQTIISDYLDKMIRSFTKLEPIEKKPSAGNWQLAMVVFAVHGSHGACLVRRSGWTRDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSLNGSQTQQNVDWQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAKEFPQCSVSLSVICPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAAFNRTGMESSALNQSLVEMDMSSVAPVSAPAATFNPAGSVMSQQPISAGNIPAATINMEPTTVTSVTGPALPHIPTARPTSQLVASLQSASPISVSEEVVPNNEIVNETKPILSGMTQPLHSFSGAAANARILNDVAQAQALVGGTSIGLQSMGETPILSNMMSGGISSSIPAAPTVLSSGQLAVTSMSGLVPLAGTGQIAQNSVSASSVSIAPSMSGNSNLCVSQLLSNIQGGVSAGMHQNVLSGTGAGMPFGQGTLMSTPRMTQQGHPGMQPLSRNNSTEANMPLSQQQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFRIASASKLLAANWPQTMQIDRLITQEHLNNERLIGKAEIVVFWAMDQHVFLGQLQEKKFCAVIQLSSQTMILSVSDKTCRLIGMLFPENMVVFKPQIPSQQLEAQHPRLEQLLLQQSLPLLQQQQPLQQLQQQQRLMPLKRKPNIPLQQQPKIPKLHRQQTPQIQQQQQIPQMQQTEQQQPIIGTCLNQASTGGTRRAQLMSQGQASSRGLPNMP
Length841
PositionUnknown
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.04
Grand average of hydropathy-0.238
Instability index55.29
Isoelectric point9.15
Molecular weight91075.35
Publications
PubMed=24807620

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12257
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      51.48|      11|      14|     526|     536|       1
---------------------------------------------------------------------------
  469-  479 (14.95/ 6.02)	IPAAPTVLSSG
  526-  536 (18.26/ 9.28)	LSNIQGGVSAG
  542-  552 (18.26/ 9.28)	LSGTGAGMPFG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      84.72|      16|      16|     773|     788|       2
---------------------------------------------------------------------------
  747-  764 (26.72/10.21)	LQQQQPLQQLQQ..QQRlmP
  773-  788 (30.66/12.79)	LQQQPKIPKLHR..QQT..P
  790-  807 (27.34/10.61)	IQQQQQIPQMQQteQQQ..P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     222.01|      46|      46|     324|     369|       3
---------------------------------------------------------------------------
  200-  248 (51.94/22.64)	..SNPY..PLPTPVYHPHMQ...NVEQSGN..IEA.............HTANrLSDAETVA.KEFPqcsvSL
  253-  310 (45.09/18.75)	PKQLPKlrAIYN.AGKRDPQaadPPIDTSK..NPNflvlisenfieacAAFN......RTG.MESS....AL
  324-  369 (77.72/37.31)	PVSAPA..ATFNPAGSVMSQ...QPISAGN..IPA.............ATIN.MEPTTVTS.VTGP....AL
  373-  417 (47.25/19.97)	PTARPT..SQL..VASLQSA...SPISVSEevVPN.............NEIV.NETKPILSgMTQP......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.72|      11|      50|     658|     668|       5
---------------------------------------------------------------------------
  658-  668 (17.55/ 9.79)	RLIGKAEIVVF
  679-  689 (16.17/ 8.43)	QLQEKKFCAVI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     136.44|      41|      72|      83|     124|       6
---------------------------------------------------------------------------
   83-  124 (67.47/43.17)	GPFWQTIISDYLDKMIRSFTKLEPIEKKPSAgNWQLAMVVFA
  158-  198 (68.97/39.72)	GGFNDAAVAESLAEALTMFSSLNGSQTQQNV.DWQRHCILIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      82.58|      22|      23|     573|     594|       7
---------------------------------------------------------------------------
  560-  580 (22.65/10.01)	...PRM.TQQGHPGMqpLSRNNSTE
  581-  604 (29.25/15.34)	ANMPLS.QQQTSATLssAQSNYVKV
  605-  627 (30.68/16.50)	WEGDLSgQRQGEPVL..ITRLQGFR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12257 with Med25 domain of Kingdom Viridiplantae
Unable to open file!