<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12256

Description mediator of RNA polymerase II transcription subunit 25-like isoform X2
SequenceMCKNALGAEKRLLIKQRKASQLEPRLEIRQKRKRGIKESEELKAEVRARTTRGEQQSICRIFGKAHMMEKQLIVAVEGTAAVGPFWQTIISDYLDKMIRSFTKLEPIEKKPSAGNWQLAMVVFAVHGSHGACLVRRSGWTRDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSLNGSQTQQNVDWQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAKEFPQCSVSLSVICPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAAFNRTGMESSALNQSLVEMDMSSVAPVSAPAATFNPAVMSQQPISAGNIPAATINMEPTTVTSVTGPALPHIPTARPTSQLVASLQSASPISVSEEVVPNNEIVNETKPILSGMTQPLHSFSGAAANARILNDVAQAQALVGGTSIGLQSMGETPILSNMMSGGISSSIPAAPTVLSSGQLAVTSMSGLVPLAGTGQIAQNSVSASSVSIAPSMSGNSNLCVSQLLSNIQGGVSAGMHQNVLSGTGAGMPFGQGTLMSTPRMTQQGHPGMQPLSRNNSTEANMPLSQQQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFRIASASKLLAANWPQTMQIDRLITQEHLNNDVRRLIGKAEIVVFWAMDQHVFLGQLQEKKFCAVIQLSSQTMILSVSDKTCRLIGMLFPENMVVFKPQIPSQQLEAQHPRLEQLLLQQSLPLLQQQQPLQQLQQQQRLMPLKRKPNIPLQQQPKIPKLHRQQTPQIQQQQQIPQMQQTEQQQPIIGTCLNQASTGGTRRAQLMSQGQASSRGLPNMP
Length841
PositionUnknown
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.04
Grand average of hydropathy-0.237
Instability index55.97
Isoelectric point9.22
Molecular weight91172.51
Publications
PubMed=24807620

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12256
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.99|      15|      15|     767|     781|       2
---------------------------------------------------------------------------
  767-  781 (28.88/11.86)	RKPNIPLQQQPKIPK
  784-  798 (26.11/ 9.99)	RQQTPQIQQQQQIPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      29.20|      12|      18|     453|     470|       3
---------------------------------------------------------------------------
  450-  467 (10.23/18.61)	GETPilsnMMSGgiSSSI
  507-  518 (18.97/ 7.74)	SIAP....SMSG..NSNL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     170.71|      53|      73|     199|     257|       4
---------------------------------------------------------------------------
  199-  228 (38.36/23.07)	...........................................ASNPyPLPTPVYHPHM..QN..VEQSGN.IEAHTA
  229-  299 (60.78/46.40)	NRlSDAETVAKEFPQCSVSLSVICPkqlpklraiynagkrdpqAADP.PIDTS.KNP.....NflVLISENfIEACAA
  301-  352 (71.57/43.33)	NR.TGMESSALNQSLVEMDMSSVAP......................vSAPAATFNPAVmsQQ..PISAGN.IPAATI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      47.06|      11|      48|     658|     668|       5
---------------------------------------------------------------------------
  658-  668 (17.55/10.64)	RLIG...KAEIVVF
  679-  689 (16.17/ 9.19)	QLQE...KKFCAVI
  706-  719 (13.34/ 6.21)	RLIGmlfPENMVVF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.07|      14|      18|     561|     576|       6
---------------------------------------------------------------------------
  556-  569 (27.06/ 9.01)	STPRMTQQGHPGMQ
  572-  585 (23.00/12.50)	SRNNSTEANMPLSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     136.44|      41|      73|      83|     124|       7
---------------------------------------------------------------------------
   83-  124 (67.47/47.81)	GPFWQTIISDYLDKMIRSFTKLEPIEKKPSAgNWQLAMVVFA
  158-  198 (68.97/44.00)	GGFNDAAVAESLAEALTMFSSLNGSQTQQNV.DWQRHCILIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.33|      10|      26|     720|     729|      11
---------------------------------------------------------------------------
  720-  729 (18.61/ 8.98)	KPQIPSQQLE
  748-  757 (18.72/ 9.09)	QQQQPLQQLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.02|      15|      30|     361|     375|      13
---------------------------------------------------------------------------
  361-  375 (27.35/16.86)	SVTGPALPH...IPTARP
  390-  407 (19.67/10.04)	SVSEEVVPNneiVNETKP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12256 with Med25 domain of Kingdom Viridiplantae
Unable to open file!