<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12255

Description mediator of RNA polymerase II transcription subunit 25-like isoform X4
SequenceMMEKQLIVAVEGTAAVGPFWQTIISDYLDKMIRSFTKLEPIEKKPSAGNWQLAMVVFAVHGSHGACLVRRSGWTRDIDMFFQWLSAIPFSGGGFNDAAVAESLAEALTMFSSLNGSQTQQNVDWQRHCILIAASNPYPLPTPVYHPHMQNVEQSGNIEAHTANRLSDAETVAKEFPQCSVSLSVICPKQLPKLRAIYNAGKRDPQAADPPIDTSKNPNFLVLISENFIEACAAFNRTGMESSALNQSLVEMDMSSVAPVSAPAATFNPAGSVMSQQPISAGNIPAATINMEPTTVTSVTGPALPHIPTARPTSQLVASLQSASPISVSEEVVPNNEIVNETKPILSGMTQPLHSFSGAAANARILNDVAQAQALVGGTSIGLQSMGETPILSNMMSGGISSSIPAAPTVLSSGQLAVTSMSGLVPLAGTGQIAQNSVSASSVSIAPSMSGNSNLCVSQLLSNIQGGVSAGMHQNVLSGTGAGMPFGQGTLMSTPRMTQQGHPGMQPLSRNNSTEANMPLSQQQTSATLSSAQSNYVKVWEGDLSGQRQGEPVLITRLQGFRIASASKLLAANWPQTMQIDRLITQEHLNNDVRRLIGKAEIVVFWAMDQHVFLGQLQEKKFCAVIQLSSQTMILSVSDKTCRLIGMLFPENMVVFKPQIPSQQLEAQHPRLEQLLLQQSLPLLQQQQPLQQLQQQQRLMPLKRKPNIPLQQQPKIPKLHRQQTPQIQQQQQIPQMQQTEQQQPIIGTCLNQASTGGTRRAQLMSQGQASSRGLPNMP
Length777
PositionUnknown
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.04
Grand average of hydropathy-0.168
Instability index56.40
Isoelectric point8.05
Molecular weight83632.68
Publications
PubMed=24807620

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12255
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      80.13|      16|      16|     701|     716|       2
---------------------------------------------------------------------------
  701-  716 (30.15/13.93)	LKRKPNIPLQQQPKIP
  718-  733 (28.60/12.79)	LHRQQTPQIQQQQQIP
  734-  746 (21.38/ 7.48)	QMQQTE...QQQPIIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             7|     284.20|      46|      48|     258|     303|       3
---------------------------------------------------------------------------
  136-  159 (27.68/10.60)	.....................................................P...........YPLPT..PVYHPHMQNVE...........Q.......SG...N..IEA
  160-  218 (36.60/16.95)	HT.ANrLSDA..ETVA.KEFPqcsvSL......................svicP...........KQLPKlrAIYN.AGKRDP...........QaadPPIDTS...K..NPN
  232-  285 (58.84/32.78)	AA.FN........RTG.MESS....AL.............nqslvemdmssvaP...........VSAPA..ATFNPAGSVMS...........Q...QPISAG...N..IPA
  286-  334 (52.75/28.45)	AT.IN.MEPT..TVTS.VTGP....AL.......................phiP...........TARPT..SQL..VASLQS...........A...SPISVS...EevVPN
  335-  405 (39.91/19.30)	NE.IV.NETK..PILSgMTQP.....LhsfsgaaanarilndvaqaqalvggtS...........IGLQS..MGETPILSNMM...........S...GGISS....S..IPA
  406-  477 (30.55/12.64)	AP.TV.LSSGqlAVTS.MSG......L.........................vPlagtgqiaqnsVSASS..VSIAPSMSGNSnlcvsqllsniQ...GGVSAGmhqN..VLS
  478-  526 (37.86/17.84)	GTgAG.MPFG..QGTL.MSTP....RM.................tqqghpgmqP...........LSRNN..ST..EANMPLS...........Q...QQTSA..........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     136.44|      41|      73|      17|      58|       4
---------------------------------------------------------------------------
   17-   58 (67.47/44.39)	GPFWQTIISDYLDKMIRSFTKLEPIEKKPSAgNWQLAMVVFA
   92-  132 (68.97/40.85)	GGFNDAAVAESLAEALTMFSSLNGSQTQQNV.DWQRHCILIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.51|      11|      31|     655|     665|       5
---------------------------------------------------------------------------
  655-  665 (20.56/10.40)	FKPQIPSQQLE
  683-  693 (19.95/ 9.85)	LQQQQPLQQLQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12255 with Med25 domain of Kingdom Viridiplantae
Unable to open file!