<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12252
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQNAQHQLLQSPARLGLPTPSSPSLQNPTTPPKFSSQLSQHLQPHQQANILTTSTTSSTLLPLLPPLSRAQSLLIQMASLSSRLFEVSPNRSHWLSAFRGSFPSFLPSAAPVPQDSYPSSSKEILSVFTSLQTQLFEAVAELQEILDLQDEKQKVTREIRSNDSAILAFANKLKGAERVLDNLVDDYSDYRRPKRVKLENDIDESSVTTVATQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYNFANLDVGLPKTDDDKEKIIEPLIEPSADITNLSAIPGLIPPNIIVPSGWKPGMPVELPTDLPLPPPGWKPGDPIALPPVDSLPLPPKVEEAPARPVPPPGLPRMPEPIQVRHVQLDIEDDSSDYSSEASSDSED |
| Length | 398 |
| Position | Middle |
| Organism | Nicotiana tabacum (Common tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.393 |
| Instability index | 76.90 |
| Isoelectric point | 4.84 |
| Molecular weight | 43468.60 |
| Publications | PubMed=24807620
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP12252
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 96.74| 18| 18| 312| 329| 1
---------------------------------------------------------------------------
236- 252 (27.64/ 9.16) EFGAGQA.PLRG.A.LPPAP
312- 329 (38.71/15.91) GWKPGMPVELPT.D.LPLPP
331- 350 (30.39/10.84) GWKPGDPIALPPvDsLPLPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 118.92| 30| 32| 6| 36| 2
---------------------------------------------------------------------------
6- 33 (46.98/20.05) ..............QHQLLQ.SPAR...LGLPTPSSPSLQNPTTPP
35- 67 (42.35/18.51) FS........sqlsQHLQPH.QQAN...I.LTTSTTSSTLLPLLPP
68- 112 (29.59/ 7.58) LSraqslliqmaslSSRLFEvSPNRshwLSAFRGSFPSFL.PSAAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.55| 12| 15| 178| 189| 3
---------------------------------------------------------------------------
178- 189 (21.34/13.99) ERV.LDNLVDDYS
195- 207 (16.21/ 9.12) KRVkLENDIDESS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.85| 15| 19| 273| 289| 6
---------------------------------------------------------------------------
275- 289 (25.78/18.86) TDDDKEKIIEPLIEP
291- 305 (26.07/11.23) ADITNLSAIPGLIPP
---------------------------------------------------------------------------
|