<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12244

Description probable mediator of RNA polymerase II transcription subunit 26b
SequenceMTKISGTLNKWRDYFQTANSDIFNVIEYAVMVAAVDYPKEFKLRRDRIAELLFTCKVIRCFGCDKVELAVPNATNDDEKFKTEFVSEFGACDVKENKSSRGDDQIGMNVNQISNYSYGEAEALTDEIEEESKTVGEVLRIKEIIDNFHVESDSDIYECLRRLQLMALSVETLKATEIGKSVNALRKHSSNNIRHLARTLVEDWKIMVEAWVNATTAFTENTPESMKASVVDEEEEGLPSPPLDDLAFISTQTTSMEFSQFFDGMDDDGNIRNSGEFNKSHENGRKDNPVRKQQFAESVTAAPKERKVEKPKKQTLVVKPNKPFGFDSGPGRPIKPTFERKLNNDEMKLLQKSDKGTIRQRHVPNQQNRLKCPDEDADRVKLEATKRKLQERYQEAEKAKRQRTIQIMELNDIHKQGLRKQGPGHKNFHVRPGNHNRHWANGHR
Length443
PositionUnknown
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.07
Grand average of hydropathy-0.864
Instability index43.63
Isoelectric point6.86
Molecular weight50807.59
Publications
PubMed=24807620

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12244
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.15|      12|      25|      53|      64|       1
---------------------------------------------------------------------------
   53-   64 (25.97/15.91)	FTCKVIRCFG.CD
   80-   92 (19.18/10.23)	FKTEFVSEFGaCD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.42|      27|      32|     169|     200|       3
---------------------------------------------------------------------------
  136-  162 (45.48/25.78)	EVLRIKEI...IDNFHVESDSDIYECLRRL
  170-  199 (37.95/29.83)	ETLKATEIgksVNALRKHSSNNIRHLARTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     122.31|      29|      66|     340|     368|       4
---------------------------------------------------------------------------
  340-  368 (48.52/31.56)	KLNNDEMKLLQKSDKGTIRQRHV.PNQQNR
  380-  405 (30.19/17.01)	KLEATKRKLQERYQEAEKAKRQR.TIQ...
  408-  436 (43.60/27.66)	ELNDIHKQGLRKQGPGH.KNFHVrPGNHNR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12244 with Med26 domain of Kingdom Viridiplantae
Unable to open file!