<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12232
Description |
mediator of RNA polymerase II transcription subunit 15a-like |
Sequence | DLQVVVVRIDLPLQLQVNHALVEEIWNINRQLIDTVVEISDEGFDPSAVASATEGGEGTTVKCSFTSVALSPSLKSQYASAQMSQIQPLRLLVPANYPDCSLVLLDEFPVEVSKKYEDHSMKAKSRFGVFLRNFSQPMSLKDIAKTWDVCARSVISECAQQNGGGTLSSKYGSWENCLSTA |
Length | 181 |
Position | Tail |
Organism | Nicotiana tabacum (Common tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.078 |
Instability index | 54.43 |
Isoelectric point | 4.90 |
Molecular weight | 19831.28 |
Publications | PubMed=24807620
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP12232
No repeats found
No repeats found
|