<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12217

Description U-box domain-containing protein 34-like isoform X2
SequenceMLCPQSLQFQLHVETLVLEGNNPATVLLKYVNDSGIKSLVLGSYSPNYFSRKLKGSSVPSIILKHAPECCDVYVVSSNKLMTNSLNPLLATEGDLPTINKQKSSASSASIDGVSHSRSSSLASSHLNFPAFLDGNSSNYVSLQQKLNQNLEDVTTGLETVKECHISTSSEQLDIQDEVERVRLELQTTLAMYNQTCEDLIHTQNKVQLFSSEYLEEYRKVNAAKKREENLRKIAAEEKERHLEAEKEVETARKLLSEETYERQIAELKALQQSLEKKKTVDALLSSDHRYRRLTREEIEVATDYFCESKMIGEGAYGKVYKGDLDHTPVAIKVLCSDASEKKEEFLREVEVLSQLHHPHIVLLLGACPENGCLVYEYMENGSLEDCILERNSKPFPWFSRFRILFEVACALAFLHNSKPEPIVHRDLKPGNILLDKNFVSKIGDVGLAKIISDVVPESVTEYRNSVLAGTLGYMDPEYQRTGTLRPKSDLYAFGIITLQLLAACRPNGLIMVFENAINSNLLVDILDKSVPDWPLMEAEELARMALKCCSLRCRDRPDLETEVLPLLKRLSEFADMRTKVEKNIIQAPSPYLCPIVQEVMEDPQIAADGFTYEHRAIKLWLTRHSVSPVTKQILQHKMVTPNRTLRLAIQEWRSQVTSFRPRS
Length663
PositionTail
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.06
Grand average of hydropathy-0.320
Instability index49.55
Isoelectric point5.88
Molecular weight75007.00
Publications
PubMed=24807620

Function

Annotated function Functions as an E3 ubiquitin ligase. 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12217
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.50|      19|      20|     221|     240|       1
---------------------------------------------------------------------------
  221-  240 (26.64/22.06)	NAAKKREENlRKIAAEEK.ER
  243-  262 (25.85/16.01)	EAEKEVETA.RKLLSEETyER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.38|      18|      20|      29|      47|       2
---------------------------------------------------------------------------
   29-   47 (24.94/19.89)	KYVNDSGIKSLVLgSYSPN
   51-   68 (28.44/17.59)	RKLKGSSVPSIIL.KHAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     123.37|      34|     135|     353|     396|       4
---------------------------------------------------------------------------
  363-  396 (65.42/59.63)	LLGACPENG.CLVYEYMENGSLEDCILERNSKPFP
  500-  534 (57.95/31.89)	LLAACRPNGlIMVFENAINSNLLVDILDKSVPDWP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.75|      20|     476|      69|      89|       5
---------------------------------------------------------------------------
   69-   89 (32.42/26.48)	CCDVYVVSSNKLMTNSLnPLL
  548-  567 (38.33/26.11)	CCSLRCRDRPDLETEVL.PLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.94|      15|     258|     197|     219|       7
---------------------------------------------------------------------------
  180-  194 (24.45/23.88)	RVRLELQTTLAMYNQ
  205-  219 (24.49/ 8.44)	KVQLFSSEYLEEYRK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12217 with Med32 domain of Kingdom Viridiplantae
Unable to open file!