<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12208
| Description |
mediator of RNA polymerase II transcription subunit 19a-like |
| Sequence | MDPDSKSFGRGPRELAGAVDLISHFKLLPHHEFFCKRSLPLSISDTHYLHNVVGDTEIRKGEGMQLDQLIQETSLSRETSSRIQPFDLDVLGEAFQLREAAPVVLPPSEKGVPTVAGKSKSESKDKDKKHKKHKDKDKEKDKEHKKHKHRHKDRSKDKDKEKKRDKSGHHDSGADHSKKHHEKKRKHDGEDLNDVHKHKRSKHKSSKIDEIGAIKVAG |
| Length | 218 |
| Position | Head |
| Organism | Nicotiana tabacum (Common tobacco) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae>
Nicotiana.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.369 |
| Instability index | 43.13 |
| Isoelectric point | 9.53 |
| Molecular weight | 24867.72 |
| Publications | PubMed=24807620
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP12208
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.59| 21| 21| 133| 153| 1
---------------------------------------------------------------------------
133- 153 (42.37/15.12) HKDKDKEKDKEHKKHKHRHKD
155- 171 (30.57/ 8.94) SKDKDKEK....KRDKSGHHD
180- 199 (28.65/ 7.93) HHEKKRKHDGEDLNDVHKHK.
---------------------------------------------------------------------------
|