<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12198

Description E3 ubiquitin-protein ligase RNF216-like isoform X6
SequenceMDSADWRTQLLPDSRQRIVNNITETLKRHLSVTREGGVQELKKIAAGFEEKIYTAATSQQDYLRKISLKMLTMETKSQNPMTNSSNAASSGQNAHDPGNAYFGSEGTAPAGAAVGVLDAADWRIQLLPDSRQSIVNKITETLKRHLPVTGEEGVQELKKIAVRFEEKIYTAAISQPDYLRKISLKMLTMETKSQHPMTNSTNAASSGQNALGPDSCQEREITQGSMKRKRENSGDNVEEHNDQILPTFTCEICTEVVPITMKFNNFHSCNHSFCSKCIERHVEVKIQLRIADIQCPYVDCGKLLDPLVCRTMIPLSIFEEWCDLLCRQAHLGFEKCYCPYQDCGEVIVKECEDVVGKSECPNCRRLICFQCGLPWNVCEENGCSKVNDTLFKELVEQKQWTKCPSCNMYVERIAGCNHMQCRCNFCFCYKCGKSPTAQRRWCRCK
Length445
PositionTail
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.07
Grand average of hydropathy-0.481
Instability index43.75
Isoelectric point7.63
Molecular weight50341.18
Publications
PubMed=24807620

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
metal ion binding	GO:0046872	IEA:UniProtKB-KW
transcription coactivator activity	GO:0003713	IEA:InterPro
transferase activity	GO:0016740	IEA:UniProtKB-KW
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12198
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     391.26|      97|     115|       1|      97|       1
---------------------------------------------------------------------------
    1-   97 (196.08/134.15)	MDSADWRTQLLPDSRQRIVNNITETLKRHLSVTREGGVQELKKIAAGFEEKIYTAATSQQDYLRKISLKMLTMETKSQNPMTNSSNAASSGQNAHDP
  117-  213 (195.18/133.50)	LDAADWRIQLLPDSRQSIVNKITETLKRHLPVTGEEGVQELKKIAVRFEEKIYTAAISQPDYLRKISLKMLTMETKSQHPMTNSTNAASSGQNALGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.00|      20|      58|     352|     372|       2
---------------------------------------------------------------------------
  311-  332 (25.10/ 7.95)	TMIPLSIFEEWCDLLCRQAhlG
  353-  372 (38.91/18.84)	DVVGKSECPNCRRLICFQC..G
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     117.10|      31|     127|     245|     280|       4
---------------------------------------------------------------------------
  245-  277 (55.39/38.25)	LPTFTCE..ICTEVVPiTMkFNNF.HSCNHSFCSKC
  373-  406 (51.65/26.57)	LPWNVCEenGCSKVND.TL.FKELvEQKQWTKCPSC
  423-  431 (10.06/ 7.13)	...........................CNFCFCYKC
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12198 with Med15 domain of Kingdom Viridiplantae

Unable to open file!