Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MLQNAPHQLLQSPARLGLPTPSSPSVQNPSPPPKFSSQVSQPHQPLQQSNMLTTTTTSSALLPLLPPLSRAQSLLIQMASLASRLFEVSPNRSHWLGAFRGSFPSFLPSGTPVPQDSFPSSSKEILSVFTSLQTQLFEAVAELQEILDLQDEKQKVIREIRSKDSSILAFANKLKEAERVLDMLVDDYSDYRRPKRAKLENDTEESSVTTVATQLKLSDILSYAHRISYTTFAPPEFGTGQAPLRGALPPAPQDEQMRASQLYNFSDLDVGLPKTDDGKETIIEPLLEPPAETNPLANIQGLITPNIVVPFGWKPGMPIELPTDLPLPPPGWKPGDPIALPPFDSLPLPPKVEEAPARPVPPPGLPRMPEPIQVRHVQLDIEDDSSDYSSDEASSDSED |
Length | 399 |
Position | Middle |
Organism | Nicotiana tabacum (Common tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.420 |
Instability index | 80.28 |
Isoelectric point | 4.73 |
Molecular weight | 43683.88 |
Publications | PubMed=24807620 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP12188 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 146.27| 28| 33| 6| 33| 2 --------------------------------------------------------------------------- 6- 33 (56.12/22.67) PHQLLQSPARLGLPTPSSPSVQN....PSPPP 42- 67 (46.32/17.41) PHQPLQQSNMLTTTTTSSALL......PLLPP 334- 363 (43.83/16.07) PGDPIALPPFDSLPLP..PKVEEaparPVPPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.13| 25| 37| 235| 268| 3 --------------------------------------------------------------------------- 194- 220 (33.58/ 9.07) PKRAKLENDTEESSVTtvATQL.KLSDI 243- 268 (40.55/30.33) PLRGALPPAPQDEQMR..ASQLyNFSDL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 95.60| 32| 37| 115| 151| 4 --------------------------------------------------------------------------- 69- 101 (47.26/30.01) SRAQSLLIQMASLASRLFEVSPNRSHWLGaFRG 120- 151 (48.34/46.66) SSSKEILSVFTSLQTQLFEAVAELQEILD.LQD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 35.39| 10| 195| 181| 191| 5 --------------------------------------------------------------------------- 181- 191 (15.71/16.78) LDmLVDDYSDY 379- 388 (19.68/13.93) LD.IEDDSSDY --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) MLQNAPHQLLQSPARLGLPTPSSPSVQNPSPPPKFSSQVSQPHQPLQQSNMLT 2) PIELPTDLPLPPPGWKPGDPIALPPFDSLPLPPKVEEAPARPVPPPGLPRMPEPIQVRHVQLDIEDDSSDYSSDEASSDSED | 1 318 | 53 399 |
MoRF Sequence | Start | Stop |
1) PGLPRMPEPIQVRHVQLDIEDDSSDYS | 363 | 389 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab