Description | mediator of RNA polymerase II transcription subunit 30-like |
Sequence | MEEKGGTMANPKTIQELAVEGQKHLEDTIEAAHQILSAMNDELCNPTLWSTTPNTAATTSANAVMSNGQQQHHSNGGGDVSSDNSSSSSASAQQHLDIGGGALDESRLRYKSSIACLRSVLTAISNSQKAKALEAASASGSLSAADQAEIEQLEERASTLKKELVDKNKHLKLLIDQLRYLLSDLSTWQSPCST |
Length | 194 |
Position | Head |
Organism | Nicotiana tabacum (Common tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.509 |
Instability index | 46.56 |
Isoelectric point | 5.19 |
Molecular weight | 20623.54 |
Publications | PubMed=24807620 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP12169 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 71.60| 21| 22| 70| 90| 1 --------------------------------------------------------------------------- 70- 90 (39.13/24.44) QQHHSNGGG..DVSSDNSSSSSA 93- 115 (32.48/19.20) QQHLDIGGGalDESRLRYKSSIA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 68.83| 22| 144| 15| 37| 2 --------------------------------------------------------------------------- 15- 37 (32.62/29.47) QELaVEGQKHLEDTIEAAHQILS 162- 183 (36.21/27.31) KEL.VDKNKHLKLLIDQLRYLLS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QQHLDI 2) SRLRYKS | 93 106 | 98 112 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab