<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12166

Description heat shock cognate 70 kDa protein 2-like
SequenceMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVNYKGEEKQFAAEEISSMVLIKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKATNVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSSDDKKKIEDAIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMYQGAGGEAGAPMDDDAPPAGGSSAGPKIEEVD
Length648
PositionUnknown
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.06
Grand average of hydropathy-0.409
Instability index33.77
Isoelectric point5.14
Molecular weight71012.62
Publications
PubMed=24807620

Function

Annotated function Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER. 
GO - Cellular Component
cytoplasm	GO:0005737	IBA:GO_Central
endoplasmic reticulum lumen	GO:0005788	IEA:UniProtKB-SubCell

GO - Biological Function
ATP binding	GO:0005524	IBA:GO_Central
ATPase activity	GO:0016887	IBA:GO_Central
heat shock protein binding	GO:0031072	IBA:GO_Central
misfolded protein binding	GO:0051787	IBA:GO_Central
protein folding chaperone	GO:0044183	IBA:GO_Central
unfolded protein binding	GO:0051082	IBA:GO_Central

GO - Biological Process
cellular response to unfolded protein	GO:0034620	IBA:GO_Central
chaperone cofactor-dependent protein refolding	GO:0051085	IBA:GO_Central
protein refolding	GO:0042026	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12166
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     214.65|      79|     187|     121|     218|       1
---------------------------------------------------------------------------
   51-  101 (41.42/14.05)	ERLIGDAAKNQVAMNPinTVF.DAKRLIGRrfsDASVQSDIKLwpFKVISGP.......................................
  136-  218 (119.16/109.84)	EAFLGSTVKNAVVTVP..AYFnDSQRQATK...DAGVISGLNV..MRIINEPTaAAIAYGLDKKATNV.GEKNVLIFDLggGTFDVSLLTI
  362-  407 (54.08/26.38)	.......................................GKEL..CKSIN.PD.EAVAYGAAVQAAILsGEGNEKVQDL..LLLDVTPLSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     342.63|     106|     289|     249|     354|       2
---------------------------------------------------------------------------
  249-  354 (178.46/118.74)	QEFKRK.HKKDITGNPRALRRLRTACERAKRTLSSTAQTTIE..IDSLYEGVDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTV..HDVVLVGGSTRIPKVQQ
  536-  646 (164.18/108.63)	EEHKKKvEAKNALENYAYNMRNTIKDEKIGSKLSSDDKKKIEdaIDQAISWLDSNQLAEADEFEDKMKELESICNPIIAKMYQGAGGEAGAPmdDDAPPAGGSSAGPKIEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.50|      23|     399|     102|     127|       3
---------------------------------------------------------------------------
  102-  127 (36.66/32.15)	GDKPMIVV.NYKGeekQFAAEEISSMV
  502-  525 (35.84/22.99)	GQKNKITItNDKG...RLSKEEIEKMV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.39|      13|      21|      10|      22|       4
---------------------------------------------------------------------------
   10-   22 (26.24/16.30)	IGIDLG..TTYSCVG
   32-   46 (21.15/11.82)	IANDQGnrTTPSYVG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12166 with Med37 domain of Kingdom Viridiplantae
Unable to open file!