<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12165

Description ATP-dependent DNA helicase Q-like 4A isoform X3
SequenceMSKDKLPKVNWTQHATAHENFSCQDKFLTSNFLFSLPTQKPCVREQMNARSMACQVRSVTKLETEKAWKLLNSLKLSSKSYTRPGKTLPLTKENKTFSQHSHNTHVPRASDVNYASARCTPLHQGVDENSEYSDTTRYAGNRFPSHSSGVAETGNVVNRQNGADTSVGNNSHSRGIGGISSNHAIGVSKTRESDSTYADGTEEDDILQNIDIDQIVEHYQTNCTPQPSVSRCPPITPVTDSKCLAGSGETNLPPELSLNCNHGLKLGLCPEALDHLQEMKDRLINISNDLLDNVSELSLEQVEMLRQERSQLKLQIQHLEKFLQTASGNEERRMSQFSASTQTSAFQYETPRAVPSRIDPIRLDAQFHGYNESGGFGNWNSSSLSFDVTGGYGLSTAPVEREPYIPKYLDVKYTEGSNDKKWSSRDFPWTKKLEADNKKVFGNPSFRPNQREVINATMSGYDVFVLMPTGGGKSLTYQLPALICPGITLVISPLVSLIQDQIMHLLQVNIPAAYLSSNMEWTEQQEILRELNSDVCKYKFLYVTPEKVAKSDVLLRHLESLHTRESLARIVIDEAHCVSQWGHDFRPDYQGLGILKQKFPTVPVLALTATATMSVKEDVVQALGLANCIIFRQSFNRPNLRYSVIPKTKKCLEDIDNFIKKFHFDQCGIIYCLSRMDCERVAEKLQEYGHKAAFYHGSMEGAQRANIQKQWSKDEINIICATVAFGMGINKPDVRFVIHHSLPKSIEGYHQECGRAGRDGLPSSCVLYYSYSDYIRVKHMISQGTVDQNSFGSGYGRSNVAASGRILETNVENLLRMVSYCENDVDCRRLLQLIHFGEKFESTNCRKTCDNCSKIQKCIEKDVTEVAKQLVELVKMTGQKFSSAHVLEVYRGSLSQYVKKHRHESLRLHGAGKHLAKGEASRVLRHLVTEDILVEDVKKSDLYGSVSSVLKVNESKAYNLFSGAQTMRLRLPSSVTQSKLGKFEATPAKGSLTSGKQSPPRTDPSAVPQSPVDTNLSAKLYTALRRLRTLLVKEAGDGVMAYHIFGDATMQQISIKVPRTTDELLDINGIGKVKITKYGDRVLETIEATINEHYKSAKTNSSGNDNTDSGKKRRNSINVQNANSKDEEDFTGSTGRSKKRVLKKQNKNPEVIDYRDLGYFDECMDGDIDFDESMMP
Length1176
PositionUnknown
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.07
Grand average of hydropathy-0.543
Instability index42.77
Isoelectric point8.32
Molecular weight131627.22
Publications
PubMed=24807620

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
3'-5' DNA helicase activity	GO:0043138	IEA:InterPro
ATP binding	GO:0005524	IEA:UniProtKB-KW
hydrolase activity	GO:0016787	IEA:UniProtKB-KW
nucleic acid binding	GO:0003676	IEA:InterPro

GO - Biological Process
DNA recombination	GO:0006310	IEA:InterPro
DNA repair	GO:0006281	IEA:InterPro
DNA replication	GO:0006260	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12165
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      78.77|      20|      23|     854|     875|       1
---------------------------------------------------------------------------
  822-  835 (18.27/ 8.23)	....ENDVD..CR.RLLQLIH
  856-  875 (32.14/24.66)	QKCIEKDVTEVAK.QLVELVK
  879-  899 (28.36/13.83)	QKFSSAHVLEVYRgSLSQYVK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.07|      15|      23|     114|     128|       2
---------------------------------------------------------------------------
  114-  128 (28.88/17.93)	YASARCTPLHQGVDE
  138-  152 (28.19/17.32)	YAGNRFPSHSSGVAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.26|      11|      23|     918|     930|       3
---------------------------------------------------------------------------
  918-  930 (13.88/13.62)	GEASRVLRhlVTE
  944-  954 (18.38/ 9.74)	GSVSSVLK..VNE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.55|      12|      26|     220|     232|       4
---------------------------------------------------------------------------
  220-  232 (20.57/16.52)	QTNCTPQPSVSrC
  249-  260 (22.99/13.07)	ETNLPPELSLN.C
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.81|      14|      23|    1110|    1123|       5
---------------------------------------------------------------------------
 1110- 1123 (23.21/14.97)	GKKRRNSINVQNAN
 1135- 1148 (22.61/14.39)	GRSKKRVLKKQNKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.02|      15|      39|     617|     631|       6
---------------------------------------------------------------------------
  617-  631 (25.97/19.20)	EDV...VQALGLANC.IIF
  653-  671 (19.05/11.95)	EDIdnfIKKFHFDQCgIIY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.91|      24|      24|     510|     533|       9
---------------------------------------------------------------------------
  510-  533 (40.73/25.66)	I.PAAYLSSNMEWTEQQEI.LRELNS
  535-  560 (30.18/17.24)	VcKYKFLYVTPEKVAKSDVlLRHLES
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.92|      18|      40|     370|     406|      10
---------------------------------------------------------------------------
  370-  389 (30.00/43.99)	YNESGGFGNWnsSSLSFDVT
  413-  430 (36.92/11.34)	YTEGSNDKKW..SSRDFPWT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.73|      23|      40|     757|     782|      11
---------------------------------------------------------------------------
  757-  782 (37.65/33.34)	GRDGLPSSC.VLYYSYSDYIRvkhMIS
  796-  819 (33.08/20.34)	GRSNVAASGrILETNVENLLR...MVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.48|      19|      30|     960|     978|      12
---------------------------------------------------------------------------
  960-  978 (33.83/19.40)	LFSGAQTMRLRLPSSVTQS
  992- 1010 (35.65/20.82)	LTSGKQSPPRTDPSAVPQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.48|      11|     409|     743|     753|      13
---------------------------------------------------------------------------
  743-  753 (23.62/14.97)	PKSIE....GYHQEC
 1149- 1163 (17.86/ 9.57)	PEVIDyrdlGYFDEC
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12165 with Med34 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) HQGVDENSEYSDTTRYAGNRFPSHSSGVAETGNVVNRQNGADTSVGNNSHSRGIGGISSNHAIGVSKTRESDSTYADGTEEDDILQNID
2) TINEHYKSAKTNSSGNDNTDSGKKRRNSINVQNANSKDEEDFTGSTGRSKKRVLKKQNK
3) YTRPGKTLPLTKENKTFSQHSHNTHVPRASDVNYASARCTP
123
1089
81
211
1147
121










Molecular Recognition Features






MoRF SequenceStartStop




1) KRVLKK
1139
1144