<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12163

Description ATP-dependent DNA helicase Q-like 4A isoform X2
SequenceMTVNSAGGSMSKDKLPKVNWTQHATAHENFSCQDKFLTSNFLFSLPTQKPCVREQMNARSMACQVRSVTKLETEKAWKLLNSLKLSSKSYTRPGKTLPLTKENKTFSQHSHNTHVPRASDVNYASARCTPLHQGVDENSEYSDTTRYAGNRFPSHSSGVAETGNVVNRQNGADTSVGNNSHSRGIGGISSNHAIGVSKTRESDSTYADGTEEDDILQNIDIDQIVEHYQTNCTPQPSVSRCPPITPVTDSKCLAGSGETNLPPELSLNCNHGLKLGLCPEALDHLQEMKDRLINISNDLLDNVSELSLEQVEMLRQERSQLKLQIQHLEKFLQTASGNEERRMSQFSASTQTSAFQYETPRAVPSRIDPIRLDAQFHGYNESGGFGNWNSSSLSFDVTGGYGLSTAPVEREPYIPKYLDVKYTEGSNDKKWSSRDFPWTKKLEADNKKVFGNPSFRPNQREVINATMSGYDVFVLMPTGGGKSLTYQLPALICPGITLVISPLVSLIQDQIMHLLQVNIPAAYLSSNMEWTEQQEILRELNSDVCKYKFLYVTPEKVAKSDVLLRHLESLHTRESLARIVIDEAHCVSQWGHDFRPDYQGLGILKQKFPTVPVLALTATATMSVKEDVVQALGLANCIIFRQSFNRPNLRYSVIPKTKKCLEDIDNFIKKFHFDQCGIIYCLSRMDCERVAEKLQEYGHKAAFYHGSMEGAQRANIQKQWSKDEINIICATVAFGMGINKPDVRFVIHHSLPKSIEGYHQECGRAGRDGLPSSCVLYYSYSDYIRVKHMISQGTVDQNSFGSGYGRSNVAASGRILETNVENLLRMVSYCENDVDCRRLLQLIHFGEKFESTNCRKTCDNCSKIQKCIEKDVTEVAKQLVELVKMTGQKFSSAHVLEVYRGSLSQYVKKHRHESLRLHGAGKHLAKGEASRVLRHLVTEDILVEDVKKSDLYGSVSSVLKVNESKAYNLFSGAQTMRLRLPSSVTQSKLGKFEATPAKGSLTSGKQSPPRTDPSAVPQSPVDTNLSAKLYTALRRLRTLLVKEAGDGVMAYHIFGDATMQQISIKVPRTTDELLDINGIGKVKITKYGDRVLETIEATINEHYKSAKTNSSGNDNTDSGKKRRNSINVQNANSKDEEDFTGSTGRSKKRVLKKQNKNPEVIDYRDLGYFDECMDGDIDFDESMMP
Length1185
PositionUnknown
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.07
Grand average of hydropathy-0.537
Instability index42.60
Isoelectric point8.32
Molecular weight132432.09
Publications
PubMed=24807620

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
3'-5' DNA helicase activity	GO:0043138	IEA:InterPro
ATP binding	GO:0005524	IEA:UniProtKB-KW
hydrolase activity	GO:0016787	IEA:UniProtKB-KW
nucleic acid binding	GO:0003676	IEA:InterPro

GO - Biological Process
DNA recombination	GO:0006310	IEA:InterPro
DNA repair	GO:0006281	IEA:InterPro
DNA replication	GO:0006260	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12163
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      78.77|      20|      23|     863|     884|       1
---------------------------------------------------------------------------
  831-  844 (18.27/ 7.45)	....ENDVD..CR.RLLQLIH
  865-  884 (32.14/22.23)	QKCIEKDVTEVAK.QLVELVK
  888-  908 (28.36/12.48)	QKFSSAHVLEVYRgSLSQYVK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.07|      15|      23|     123|     137|       2
---------------------------------------------------------------------------
  123-  137 (28.88/17.72)	YASARCTPLHQGVDE
  147-  161 (28.19/17.12)	YAGNRFPSHSSGVAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.26|      11|      23|     927|     939|       3
---------------------------------------------------------------------------
  927-  939 (13.88/16.90)	GEASRVLRhlVTE
  953-  963 (18.38/12.14)	GSVSSVLK..VNE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.55|      12|      26|     229|     241|       4
---------------------------------------------------------------------------
  229-  241 (20.57/16.66)	QTNCTPQPSVSrC
  258-  269 (22.99/13.18)	ETNLPPELSLN.C
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.81|      14|      23|    1119|    1132|       5
---------------------------------------------------------------------------
 1119- 1132 (23.21/15.07)	GKKRRNSINVQNAN
 1144- 1157 (22.61/14.49)	GRSKKRVLKKQNKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.02|      15|      39|     626|     640|       6
---------------------------------------------------------------------------
  626-  640 (25.97/17.93)	EDV...VQALGLANC.IIF
  662-  680 (19.05/11.17)	EDIdnfIKKFHFDQCgIIY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.91|      24|      24|     519|     542|       9
---------------------------------------------------------------------------
  519-  542 (40.73/22.97)	I.PAAYLSSNMEWTEQQEI.LRELNS
  544-  569 (30.18/15.47)	VcKYKFLYVTPEKVAKSDVlLRHLES
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.92|      18|      40|     379|     415|      10
---------------------------------------------------------------------------
  379-  398 (30.00/49.15)	YNESGGFGNWnsSSLSFDVT
  422-  439 (36.92/12.68)	YTEGSNDKKW..SSRDFPWT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.73|      23|      40|     766|     791|      11
---------------------------------------------------------------------------
  766-  791 (37.65/30.77)	GRDGLPSSC.VLYYSYSDYIRvkhMIS
  805-  828 (33.08/18.76)	GRSNVAASGrILETNVENLLR...MVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.48|      19|      30|     969|     987|      12
---------------------------------------------------------------------------
  969-  987 (33.83/18.59)	LFSGAQTMRLRLPSSVTQS
 1001- 1019 (35.65/19.95)	LTSGKQSPPRTDPSAVPQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.48|      11|     409|     752|     762|      13
---------------------------------------------------------------------------
  752-  762 (23.62/15.29)	PKSIE....GYHQEC
 1158- 1172 (17.86/ 9.66)	PEVIDyrdlGYFDEC
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12163 with Med34 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) HQGVDENSEYSDTTRYAGNRFPSHSSGVAETGNVVNRQNGADTSVGNNSHSRGIGGISSNHAIGVSKTRESDSTYADGTEEDDILQNID
2) TINEHYKSAKTNSSGNDNTDSGKKRRNSINVQNANSKDEEDFTGSTGRSKKRVLKKQNK
3) YTRPGKTLPLTKENKTFSQHSHNTHVPRASDVNYASARCTP
132
1098
90
220
1156
130










Molecular Recognition Features






MoRF SequenceStartStop




1) KRVLKK
1148
1153