<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12161

Description heat shock cognate 70 kDa protein 2-like
SequenceMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIPGPADKPMIVVNYKGEEKQFSAEEISSMVLVKMKEIAEAFLGTTIKNAVVTVPAYFNDSQRQATKDAGIISGLNVMRIINEPTAAAIAYGLDKKAGSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYTTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSGVHDIVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNERVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERARTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVEAKNALENYAYNMRNTIKDEKIGSKLSPDDKKKIEDAIDEAISWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGPDMAGGMDEDGPSAGASGAGPKIEEVD
Length648
PositionUnknown
OrganismNicotiana tabacum (Common tobacco)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana.
Aromaticity0.06
Grand average of hydropathy-0.430
Instability index33.12
Isoelectric point5.11
Molecular weight71086.75
Publications
PubMed=24807620

Function

Annotated function Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER.
GO - Cellular Component
cytoplasm	GO:0005737	IBA:GO_Central
endoplasmic reticulum lumen	GO:0005788	IEA:UniProtKB-SubCell
GO - Biological Function
ATP binding	GO:0005524	IBA:GO_Central
ATPase activity	GO:0016887	IBA:GO_Central
heat shock protein binding	GO:0031072	IBA:GO_Central
misfolded protein binding	GO:0051787	IBA:GO_Central
protein folding chaperone	GO:0044183	IBA:GO_Central
unfolded protein binding	GO:0051082	IBA:GO_Central
GO - Biological Process
cellular response to unfolded protein	GO:0034620	IBA:GO_Central
chaperone cofactor-dependent protein refolding	GO:0051085	IBA:GO_Central
protein refolding	GO:0042026	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP12161
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     226.34|      55|     189|     159|     225|       1
---------------------------------------------------------------------------
  159-  213 (89.67/44.41)	RQATKDAGIISGLNVMRIINEPTAAAIAYGLDKKAG.SSGEKNVLIFDLGGGTFDV
  353-  402 (73.81/34.42)	QQLLQD..FFNGKELCKSIN.PD.EAVAYGAAVQAAiLSGEGNERVQDL..LLLDV
  425-  469 (62.87/38.88)	TIPTKKEQVFSTYS....DNQPGVLIQVYE.GERAR.TRDNNLLGKFELSG.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      76.27|      18|      21|      38|      55|       2
---------------------------------------------------------------------------
   16-   33 (19.08/10.53)	....TTYSCVGVWQHDRveIIA
   38-   55 (32.67/23.11)	NR..TTPSYVAFTDTER..LIG
   60-   78 (24.52/15.57)	NQvaMNPTNTVF.DAKR..LIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.31|      24|     399|     100|     127|       4
---------------------------------------------------------------------------
  100-  127 (33.62/34.38)	GPADKpMIVVNYKGeekQFSAEEISSMV
  502-  525 (41.69/26.97)	GQKNK.ITITNDKG...RLSKEEIEKMV
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP12161 with Med37 domain of Kingdom Viridiplantae

Unable to open file!