Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MNESKTRSITHNPNLSMDSSKKNSAAGIYNDASPANDTATTAGSPAEDLKQNINESINSIEKTLGILHQLYLTVSSYNVSSQLLLLQCLNNLVLELDNMVKFGGKCNIQVPMEVLNLIDNGKNPDEFTRDVLNSCIAKNQITKGKTDAFKGLRRHLLEELEQAFPEEV |
Length | 168 |
Position | Middle |
Organism | Nicotiana tabacum (Common tobacco) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Nicotianoideae> Nicotianeae> Nicotiana. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.428 |
Instability index | 51.39 |
Isoelectric point | 5.20 |
Molecular weight | 18522.69 |
Publications | PubMed=24807620 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP12156 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 42.58| 14| 15| 91| 105| 1 --------------------------------------------------------------------------- 91- 105 (18.63/12.80) NLVLELDNMVKfGGK 109- 122 (23.95/11.82) QVPMEVLNLID.NGK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) SAAGIY 2) TRSITHNPNL | 24 6 | 29 15 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab