<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12139
| Description |
cyclin-C isoform X2 |
| Sequence | MAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKSFDERKEMAAILSKMPKPRPPPSRNSLSDSPLVAGPEAAR |
| Length | 197 |
| Position | Kinase |
| Organism | Erinaceus europaeus (Western European hedgehog) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Eulipotyphla> Erinaceidae> Erinaceinae>
Erinaceus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | 0.063 |
| Instability index | 51.82 |
| Isoelectric point | 6.31 |
| Molecular weight | 22801.63 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12139
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.12| 13| 24| 130| 143| 1
---------------------------------------------------------------------------
130- 143 (20.63/16.64) QW..FAELSvDMEKIL
155- 169 (20.49/11.63) QWksFDERK.EMAAIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.43| 20| 27| 54| 75| 3
---------------------------------------------------------------------------
54- 75 (34.97/30.45) EFYLLELmdCCLIVYHPYRPLL
84- 103 (37.46/24.93) EDMLLPL..AWRIVNDTYRTDL
---------------------------------------------------------------------------
|