| Description | mediator of RNA polymerase II transcription subunit 32 |
| Sequence | MDSVVDSLNNAYQDFVSAAANVLEAKENAGSVKTTATDTALENFKQKWELFRVACDQAEEFVESVKQRIGSECLVDEATRPVAGKPGQATMTGLPPISAVRLEQMSKAVRWLVIELQHGSGASSANSALSHPSAPFDARFSEDATQ |
| Length | 146 |
| Position | Tail |
| Organism | Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.284 |
| Instability index | 49.09 |
| Isoelectric point | 4.78 |
| Molecular weight | 15674.27 |
| Publications | PubMed=25384727 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP12127 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) GLPPISAVRLEQ 2) PFDARFSEDATQ | 93 135 | 104 146 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab