<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12102
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASKNESDNSTHTSPSSPKNTYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNANFRNAMAHPINKELAHRQQFYFWKNYRNNRLKHILPRSLPEPSATSAVPAPLSTPAQAPASALPPVPSTSVAVTTTPTQAPSPMSYGMPPGSGLAKNDMRNPTVDNRRKRK |
| Length | 207 |
| Position | Middle |
| Organism | Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.716 |
| Instability index | 60.60 |
| Isoelectric point | 9.47 |
| Molecular weight | 23768.69 |
| Publications | PubMed=25384727
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12102
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.93| 19| 22| 134| 155| 1
---------------------------------------------------------------------------
134- 155 (26.40/23.41) SLPE.PSATSAVpAplSTPAQAP
158- 177 (32.52/16.45) ALPPvPSTSVAV.T..TTPTQAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.57| 20| 28| 32| 51| 2
---------------------------------------------------------------------------
32- 51 (36.56/21.38) FLLELEFVQCLANPTYIHYL
62- 81 (39.01/23.19) FIGYLKYLQYWQRPEYIKFI
---------------------------------------------------------------------------
|