<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12101
| Description |
mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MDIISQLQEQVNLIAHLAFNTIGTLQRDAPPNRLSPNYPEPPAHPTEEGTNFSEQPKLMSSTLVKAAKQFDALVAALPISESGEEAQLKRITELQAENDAIGQELQKQLEAAEKELNQVQELFRQASDNCLNLKKPDDN |
| Length | 139 |
| Position | Middle |
| Organism | Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.638 |
| Instability index | 56.73 |
| Isoelectric point | 4.58 |
| Molecular weight | 15418.05 |
| Publications | PubMed=25384727
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12101
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.22| 13| 16| 95| 108| 1
---------------------------------------------------------------------------
95- 108 (17.36/17.24) QAENDAIgQELQKQ
113- 125 (20.86/13.88) EKELNQV.QELFRQ
---------------------------------------------------------------------------
|