<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12085

Description mediator of RNA polymerase II transcription subunit 36a
SequenceMAPPRGRGGGGGGFRGGRGDRGRGRGGGGRGGDRGTPFKARGGGRGGGRGGGRGGGRGGGRGGMKGGSKVVVQPHRHGGIFIAKGKEDALVTKNLVPGEAVYNEKRVTVQNEDGSKDEYRIWNPFRSKLAAAILGGVDNIWIKPGARVLYLGAASGTTVSHVSDIVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILGLNASYYLKAGGHFVISIKANCIDSTVPAEAVFESEVNKLKADQFKPFEQVTLEPFERDHACVVGGYRVPKKKKDIAA
Length309
PositionUnknown
OrganismVigna radiata var. radiata (Mung bean) (Phaseolus aureus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
Aromaticity0.07
Grand average of hydropathy-0.414
Instability index29.25
Isoelectric point10.16
Molecular weight32613.76
Publications
PubMed=25384727

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
methyltransferase activity	GO:0008168	IEA:UniProtKB-KW
RNA binding	GO:0003723	IEA:UniProtKB-KW

GO - Biological Process
methylation	GO:0032259	IEA:UniProtKB-KW
rRNA processing	GO:0006364	IEA:UniProtKB-KW









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12085
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.03|      17|      17|     189|     205|       3
---------------------------------------------------------------------------
  169-  192 (20.30/11.04)	TGVVYAVEfshrsgrDLVNMAKKR
  193-  209 (30.72/19.73)	TNVIPIIE.......DARHPAKYR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.60|      16|      17|      57|      72|       4
---------------------------------------------------------------------------
   57-   72 (28.75/10.21)	RGGGRGGM...KGGSKVVV
   73-   91 (21.85/ 6.04)	QPHRHGGIfiaKGKEDALV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      29.90|       9|      18|     114|     124|       5
---------------------------------------------------------------------------
  114-  124 (14.62/14.09)	GSKDEyrIW.NP
  135-  144 (15.28/ 6.86)	GGVDN..IWiKP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12085 with Med36 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MAPPRGRGGGGGGFRGGRGDRGRGRGGGGRGGDRGTPFKARGGGRGGGRGGGRGGGRGGGRGGMKGGSKVV
1
71










Molecular Recognition Features






MoRF SequenceStartStop




1) MAPPRGRGGGGGGFRGGRGDRGRGRGGGGRGGDRGTPFKARGGGRGGGRGGG
1
52