<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12081
Description |
mediator of RNA polymerase II transcription subunit 22b |
Sequence | MNKGGAAGLGGGAGAGSGPTAAAASAAAQKQKTLLQRVEGDIANIVDNFSHLVNVARVNDPPVRNSQEAFMMEMRSARMVQAADSLLKLVSELKQTAIFSGFASLNDHVEQRRIEFNQLAEKTDHTLSKVGEEAAANLKELESHYSSSAQKIMQNLQP |
Length | 158 |
Position | Head |
Organism | Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.337 |
Instability index | 40.44 |
Isoelectric point | 6.42 |
Molecular weight | 16805.72 |
Publications | PubMed=25384727
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP12081
No repeats found
No repeats found
|