<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12076

Description U-box domain-containing protein 33
SequenceMELLKPLHPHHAPILCLPFHGHPSSSQSQSQLPLPMPPKVHVAVGKSIDKAVTLLQWTFKHFQNSEIVILHAYQPSLTIPTLLGKLPASQASPAVVSAFRSVEREQTMKLLDKYLTVCRTARVKASVIVTEVDQVQKGIVDLVVKHNIQKLVIGAVPENCMKVKRNSGKANYTAKNAPPFCEVWFIYKGKVIWTREASETPCSSSLSTQPEIATAESLRCRSFQYGKNELFDSECLQPNSARSATGFGIGSWVHGEITETGATFSSKASSCSSHCSSQNSSRAHLDTYLEAMEEKINNQLIETKREAEAVADEASAELLKCERLEVEAMEAIRKVNLFDSARVREVKLRKEAEDALRATVEEQQKLLSESEKIANELQMTMRNIALLDSRAQEANRRRDEAADELSLIQESISTLWQERQQIRRHKMESLRWLERWRSRGQVGAAHCNGVIGFPEELPELAEFSSSDLQNATCNFSNSFKIVQGGFGCIYKGEMMGRTVTIKRFHQHNMQGPMEFRQEVQVLGSLQHPHLITLLGVCPEAWSIVYEYLPNGTLQDYLFRKSNNSPLTWNTRARMIAEIASALCFLHSFKPETIIHGDLKPETVLLDSSLRCKICGFGFCSLVSEESLLRPSFRLSTEPKGAFTYTDPEFHRTGILTTKSDIYSFGLIILQLLTGNTPVGLATLVRNAASCGKLSSILDSSAGEWPSPVASRLVELGLQFCQQNRRDRPDLTPTLVRELEQMHASEERPVPSFFLCPILQEIMHDPQVAADGFTYEGDALREWLENGHDTSPMTNLKLNHLFLTPNHALRLAIQDWLCKS
Length819
PositionTail
OrganismVigna radiata var. radiata (Mung bean) (Phaseolus aureus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Vigna.
Aromaticity0.07
Grand average of hydropathy-0.290
Instability index50.59
Isoelectric point6.62
Molecular weight91811.89
Publications
PubMed=25384727

Function

Annotated function Functions as an E3 ubiquitin ligase. 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP12076
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     184.34|      53|     389|     209|     261|       1
---------------------------------------------------------------------------
  209-  261 (96.36/60.18)	QPE.IATAESLRCRSFQYGKNELFDSECLQPNSAR.SATGFGIGSWVHGEITETG
  599-  653 (87.99/54.32)	KPEtVLLDSSLRCKICGFGFCSLVSEESLLRPSFRlSTEPKGAFTYTDPEFHRTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      84.03|      31|      46|     306|     351|       2
---------------------------------------------------------------------------
  321-  355 (39.77/34.27)	CERLEVEAMEAIRKVNLFDSaRVREVKLR..keaEDA
  370-  405 (44.26/30.59)	SEKIANELQMTMRNIALLDS.RAQEANRRrdeaaDEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     127.44|      34|     450|      45|      87|       3
---------------------------------------------------------------------------
   45-   78 (58.19/29.89)	GKSIDKAVTLLQWTFKHFQN.....S............EIV....ILHAYQ.PSLT
  492-  531 (47.45/22.09)	GEMMGRTVTIKRFHQHNMQGpmefrQ............EVQ....VLGSLQhPHLI
  552-  593 (21.80/14.85)	........TLQDYLFRKSNN.....SpltwntrarmiaEIAsalcFLHSFK.PETI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.16|      19|     651|      80|      99|       5
---------------------------------------------------------------------------
   80-   99 (30.12/23.62)	PTL...LGKLPASQASPaVVSAF
  732-  753 (32.04/20.16)	PTLvreLEQMHASEERP.VPSFF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP12076 with Med32 domain of Kingdom Viridiplantae
Unable to open file!