<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12043
| Description |
mediator of RNA polymerase II transcription subunit 25 |
| Sequence | MQMTMRASGAPNQQPPVTGAPTNQVAQGGQAPPQGAMLRLPNPGANPQLRSLLLSQQQPQGGVGHMQGMMPHQGLGGQLVHPTPGAGPQMQAQWRQPLAGQMMMAAGQRGPGAQPPGMPQVSSVMEDEILMDLI |
| Length | 134 |
| Position | Unknown |
| Organism | Salmo salar (Atlantic salmon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Salmo.
|
| Aromaticity | 0.01 |
| Grand average of hydropathy | -0.453 |
| Instability index | 50.23 |
| Isoelectric point | 9.21 |
| Molecular weight | 13940.96 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP12043
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.96| 18| 24| 62| 85| 1
---------------------------------------------------------------------------
62- 85 (26.43/16.71) GVGHMqgMM..PHQGLGGQlvhPtPG
98- 117 (33.52/ 8.52) LAGQM..MMaaGQRGPGAQ...P.PG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.71| 17| 23| 13| 35| 2
---------------------------------------------------------------------------
13- 35 (27.50/17.26) QQPPVTGaptnqvAQGGQAPPQG
45- 61 (28.22/ 8.48) ANPQLRS......LLLSQQQPQG
---------------------------------------------------------------------------
|