Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTEMFSNLYGQNEAQGPPGSSSLGFGPGKPPPPLPPNQVTMAAQMPPQHGDEGPALRKPGAMNEPFYLLRELPVGNELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDCPGTQDGSSLRSLIEKPPVCGNSFSPLTGASLTGFRLHTGPLPEQYRLMHIQPPKKKSKNKHKHHRPQDPIPQETPSDSDPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDHPGLAGSQPNSNSLR |
Length | 244 |
Position | Head |
Organism | Salmo salar (Atlantic salmon) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes> Salmonidae> Salmoninae> Salmo. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.156 |
Instability index | 51.65 |
Isoelectric point | 9.74 |
Molecular weight | 27020.52 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP12040 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 92.46| 23| 26| 14| 36| 1 --------------------------------------------------------------------------- 14- 36 (47.01/20.21) AQGPPGSSSLGFGPGKPPPPLPP 43- 65 (45.45/19.29) AQMPPQHGDEGPALRKPGAMNEP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 88.99| 20| 20| 187| 206| 2 --------------------------------------------------------------------------- 159- 184 (23.40/ 7.33) .PLPEqyrlmhiQPPKKKSKNKHKHHR 187- 206 (36.41/14.96) DPIPQ.......ETPSDSDPKKKKKKR 209- 225 (29.18/10.71) DPDRK.......KKKKD...KKKKKNR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.58| 18| 21| 109| 128| 3 --------------------------------------------------------------------------- 109- 128 (30.71/21.73) FL..PELPGMIDCPGTqdGSSL 131- 150 (27.86/13.76) LIekPPVCGNSFSPLT..GASL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DPKKKKKKRDDDPDRKKKKKDKKKKKNRHSPDH 2) FYLLR 3) KHKHH 4) YRLMHIQP | 198 66 179 164 | 230 70 183 171 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab