<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12028
Description |
mediator of RNA polymerase II transcription subunit 28 |
Sequence | MSSSMGSGMFPGQQSAGPHPVGGPGQPGLLSGAPGNRVQGPNTLVDDLEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPDQVVKEDVSELRNELQRKELLVQKHLSKLHHWQQVLEDVSVQHRKPSDLPPPGPLAFLEQASAILPAAPLKQS |
Length | 180 |
Position | Head |
Organism | Salmo salar (Atlantic salmon) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Salmo.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.437 |
Instability index | 53.51 |
Isoelectric point | 5.50 |
Molecular weight | 19661.00 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP12028
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.28| 11| 22| 7| 18| 2
---------------------------------------------------------------------------
7- 18 (18.70/13.31) SGMfPGQQSAGP
31- 41 (22.58/11.12) SGA.PGNRVQGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.92| 15| 28| 101| 116| 3
---------------------------------------------------------------------------
101- 116 (22.88/15.10) QLSVQKP.......DQVVkEDVS
126- 147 (20.04/ 8.89) ELLVQKHlsklhhwQQVL.EDVS
---------------------------------------------------------------------------
|