<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP12015
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAVTDKSTKERLLSVLDDLEVLSRELIEMLALSRSQKLPQGGEDTQILELLVQRDREFQELMGVAQEQGKVHQEMQVLEKEVEKRDCDIQQLQKQLKEAEHILATAVYQAKEKLKSIDKARKGSISSEEIIKYAHRISASNAVCAPLNWVPGDPRRPYPTDLEMRSGMLGHMSNLPTNGVNGHLPGDALAAGRLPDVLTPQYPWQSSDVSVGMLPPHHGNDFGLEPPGHNKENEDDVEAMSTDSSSSSSDSD |
| Length | 252 |
| Position | Middle |
| Organism | Salmo salar (Atlantic salmon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Salmo.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.638 |
| Instability index | 50.35 |
| Isoelectric point | 4.97 |
| Molecular weight | 27916.03 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP12015
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.27| 18| 32| 24| 55| 1
---------------------------------------------------------------------------
19- 36 (27.97/ 7.94) LEVL...SRELIEMLALSRSQ
48- 68 (25.30/33.76) LELLvqrDREFQELMGVAQEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.43| 14| 32| 140| 153| 2
---------------------------------------------------------------------------
140- 153 (28.63/17.08) SNAVCAPLN.WVPGD
173- 187 (22.80/12.46) SNLPTNGVNgHLPGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.81| 30| 33| 71| 102| 3
---------------------------------------------------------------------------
71- 102 (42.50/36.69) VHQEMQVLeKEVEK.RDCDIQQlQKQLKEAEHI
107- 137 (44.31/28.71) VYQAKEKL.KSIDKaRKGSISS.EEIIKYAHRI
---------------------------------------------------------------------------
|