| Description | mediator of RNA polymerase II transcription subunit 24-like |
| Sequence | MTGKQKMLCSTIIERKRVTFFSYVTRVKWAILKAPLGDRSMSTSLSAPYGQHEGPSQPRPSQPVPEDLMKECVECLEQGSCGSILQFMPFTMVSELVKLPVLAKPKVVLGITDLTLPLGRSVAAKASFAL |
| Length | 130 |
| Position | Tail |
| Organism | Salmo salar (Atlantic salmon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes> Salmonidae> Salmoninae> Salmo. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.077 |
| Instability index | 68.23 |
| Isoelectric point | 9.36 |
| Molecular weight | 14227.73 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP12009 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) SLSAPYGQHE 2) VKWAILKAPL | 44 27 | 53 36 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab